SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15800225|ref|NP_286237.1| from Escherichia coli O157:H7 str. EDL933

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15800225|ref|NP_286237.1|
Domain Number 1 Region: 95-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000732
Family NfeD domain-like 0.0089
Further Details:      
 
Weak hits

Sequence:  gi|15800225|ref|NP_286237.1|
Domain Number - Region: 32-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000589
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15800225|ref|NP_286237.1|
Sequence length 152
Comment hypothetical protein Z0641 [Escherichia coli O157:H7 str. EDL933]
Sequence
MMELIVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMF
AVLTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSS
WPVSASEDLGAGTHVEVIAIEGITLIIRAVIA
Download sequence
Identical sequences A0A0F6C027 A0A0F6F251 A0A0H3PSV3 A0A1Z3UTS0 A0A2H1BG00 D3QKI0 Q8KY49 Q8XD05
gi|209397476|ref|YP_002269148.1| gi|254791680|ref|YP_003076517.1| gi|291281401|ref|YP_003498219.1| gi|387881091|ref|YP_006311393.1| 155864.Z0641 444450.ECH74115_0592 544404.ECSP_0565 NP_308578.2.58667 WP_000970311.1.10001 WP_000970311.1.100073 WP_000970311.1.10010 WP_000970311.1.100299 WP_000970311.1.100302 WP_000970311.1.100508 WP_000970311.1.100554 WP_000970311.1.100925 WP_000970311.1.101105 WP_000970311.1.101166 WP_000970311.1.101206 WP_000970311.1.101628 WP_000970311.1.10206 WP_000970311.1.102094 WP_000970311.1.102139 WP_000970311.1.10273 WP_000970311.1.10335 WP_000970311.1.10476 WP_000970311.1.10761 WP_000970311.1.10970 WP_000970311.1.1111 WP_000970311.1.11240 WP_000970311.1.11301 WP_000970311.1.11420 WP_000970311.1.11671 WP_000970311.1.11690 WP_000970311.1.12259 WP_000970311.1.12305 WP_000970311.1.12552 WP_000970311.1.13060 WP_000970311.1.13217 WP_000970311.1.13223 WP_000970311.1.13332 WP_000970311.1.13348 WP_000970311.1.13430 WP_000970311.1.13442 WP_000970311.1.13481 WP_000970311.1.13881 WP_000970311.1.13936 WP_000970311.1.13939 WP_000970311.1.14110 WP_000970311.1.14453 WP_000970311.1.14621 WP_000970311.1.14748 WP_000970311.1.15356 WP_000970311.1.15527 WP_000970311.1.1559 WP_000970311.1.15626 WP_000970311.1.15702 WP_000970311.1.15782 WP_000970311.1.16075 WP_000970311.1.16133 WP_000970311.1.16222 WP_000970311.1.16272 WP_000970311.1.16463 WP_000970311.1.16481 WP_000970311.1.16845 WP_000970311.1.17187 WP_000970311.1.1731 WP_000970311.1.17386 WP_000970311.1.17415 WP_000970311.1.17515 WP_000970311.1.17904 WP_000970311.1.18112 WP_000970311.1.18136 WP_000970311.1.18326 WP_000970311.1.1834 WP_000970311.1.18340 WP_000970311.1.1881 WP_000970311.1.18837 WP_000970311.1.18995 WP_000970311.1.19039 WP_000970311.1.191 WP_000970311.1.19140 WP_000970311.1.19350 WP_000970311.1.19419 WP_000970311.1.19840 WP_000970311.1.19847 WP_000970311.1.2005 WP_000970311.1.20264 WP_000970311.1.20449 WP_000970311.1.20480 WP_000970311.1.20546 WP_000970311.1.20594 WP_000970311.1.20745 WP_000970311.1.20893 WP_000970311.1.20941 WP_000970311.1.20950 WP_000970311.1.20989 WP_000970311.1.21508 WP_000970311.1.21666 WP_000970311.1.21668 WP_000970311.1.21962 WP_000970311.1.2218 WP_000970311.1.22251 WP_000970311.1.22304 WP_000970311.1.22381 WP_000970311.1.22594 WP_000970311.1.22743 WP_000970311.1.22925 WP_000970311.1.23073 WP_000970311.1.23115 WP_000970311.1.23241 WP_000970311.1.23323 WP_000970311.1.23355 WP_000970311.1.23467 WP_000970311.1.23790 WP_000970311.1.23806 WP_000970311.1.23838 WP_000970311.1.2388 WP_000970311.1.23895 WP_000970311.1.23899 WP_000970311.1.23973 WP_000970311.1.23984 WP_000970311.1.24070 WP_000970311.1.24283 WP_000970311.1.24341 WP_000970311.1.24753 WP_000970311.1.24854 WP_000970311.1.24870 WP_000970311.1.25076 WP_000970311.1.25082 WP_000970311.1.25088 WP_000970311.1.25201 WP_000970311.1.25305 WP_000970311.1.25526 WP_000970311.1.25577 WP_000970311.1.25794 WP_000970311.1.25819 WP_000970311.1.25831 WP_000970311.1.26066 WP_000970311.1.26105 WP_000970311.1.26121 WP_000970311.1.26134 WP_000970311.1.26246 WP_000970311.1.26474 WP_000970311.1.26525 WP_000970311.1.26590 WP_000970311.1.26761 WP_000970311.1.26878 WP_000970311.1.26975 WP_000970311.1.26998 WP_000970311.1.27338 WP_000970311.1.27445 WP_000970311.1.28143 WP_000970311.1.28551 WP_000970311.1.28734 WP_000970311.1.28879 WP_000970311.1.291 WP_000970311.1.29126 WP_000970311.1.29404 WP_000970311.1.29564 WP_000970311.1.29597 WP_000970311.1.29618 WP_000970311.1.2978 WP_000970311.1.29818 WP_000970311.1.29976 WP_000970311.1.30 WP_000970311.1.30019 WP_000970311.1.30052 WP_000970311.1.30064 WP_000970311.1.30164 WP_000970311.1.30476 WP_000970311.1.30637 WP_000970311.1.30918 WP_000970311.1.30993 WP_000970311.1.30999 WP_000970311.1.31055 WP_000970311.1.312 WP_000970311.1.31252 WP_000970311.1.3140 WP_000970311.1.31401 WP_000970311.1.31575 WP_000970311.1.31715 WP_000970311.1.31956 WP_000970311.1.32063 WP_000970311.1.322 WP_000970311.1.32243 WP_000970311.1.32536 WP_000970311.1.32574 WP_000970311.1.32590 WP_000970311.1.32888 WP_000970311.1.32931 WP_000970311.1.3295 WP_000970311.1.33049 WP_000970311.1.33055 WP_000970311.1.33094 WP_000970311.1.33125 WP_000970311.1.33146 WP_000970311.1.33167 WP_000970311.1.33178 WP_000970311.1.33268 WP_000970311.1.33981 WP_000970311.1.34224 WP_000970311.1.34269 WP_000970311.1.34383 WP_000970311.1.34500 WP_000970311.1.34680 WP_000970311.1.34686 WP_000970311.1.35393 WP_000970311.1.3550 WP_000970311.1.36010 WP_000970311.1.36212 WP_000970311.1.36626 WP_000970311.1.36767 WP_000970311.1.37102 WP_000970311.1.37337 WP_000970311.1.37372 WP_000970311.1.3762 WP_000970311.1.37731 WP_000970311.1.37766 WP_000970311.1.37769 WP_000970311.1.3795 WP_000970311.1.38050 WP_000970311.1.38063 WP_000970311.1.38107 WP_000970311.1.38306 WP_000970311.1.38369 WP_000970311.1.38835 WP_000970311.1.389 WP_000970311.1.38958 WP_000970311.1.39180 WP_000970311.1.39268 WP_000970311.1.39310 WP_000970311.1.39415 WP_000970311.1.39564 WP_000970311.1.39601 WP_000970311.1.39646 WP_000970311.1.39820 WP_000970311.1.40113 WP_000970311.1.40234 WP_000970311.1.4030 WP_000970311.1.40549 WP_000970311.1.40629 WP_000970311.1.40742 WP_000970311.1.40758 WP_000970311.1.40793 WP_000970311.1.40882 WP_000970311.1.40900 WP_000970311.1.40952 WP_000970311.1.4103 WP_000970311.1.41060 WP_000970311.1.41294 WP_000970311.1.41330 WP_000970311.1.41478 WP_000970311.1.41536 WP_000970311.1.41734 WP_000970311.1.41849 WP_000970311.1.42036 WP_000970311.1.4213 WP_000970311.1.42447 WP_000970311.1.4250 WP_000970311.1.42513 WP_000970311.1.42594 WP_000970311.1.4261 WP_000970311.1.42863 WP_000970311.1.42975 WP_000970311.1.43013 WP_000970311.1.43079 WP_000970311.1.43121 WP_000970311.1.4313 WP_000970311.1.43140 WP_000970311.1.43196 WP_000970311.1.43384 WP_000970311.1.43448 WP_000970311.1.43469 WP_000970311.1.43536 WP_000970311.1.43604 WP_000970311.1.43754 WP_000970311.1.43798 WP_000970311.1.43816 WP_000970311.1.43837 WP_000970311.1.43911 WP_000970311.1.43939 WP_000970311.1.44165 WP_000970311.1.44203 WP_000970311.1.44389 WP_000970311.1.44488 WP_000970311.1.44561 WP_000970311.1.44733 WP_000970311.1.44906 WP_000970311.1.44954 WP_000970311.1.45020 WP_000970311.1.45076 WP_000970311.1.45153 WP_000970311.1.45195 WP_000970311.1.45293 WP_000970311.1.45404 WP_000970311.1.45575 WP_000970311.1.45707 WP_000970311.1.45841 WP_000970311.1.45901 WP_000970311.1.45941 WP_000970311.1.46039 WP_000970311.1.4619 WP_000970311.1.46282 WP_000970311.1.46369 WP_000970311.1.46414 WP_000970311.1.46451 WP_000970311.1.46503 WP_000970311.1.46597 WP_000970311.1.46611 WP_000970311.1.46626 WP_000970311.1.46810 WP_000970311.1.46832 WP_000970311.1.46913 WP_000970311.1.4708 WP_000970311.1.47140 WP_000970311.1.4723 WP_000970311.1.47411 WP_000970311.1.47784 WP_000970311.1.47827 WP_000970311.1.47884 WP_000970311.1.47954 WP_000970311.1.47994 WP_000970311.1.48065 WP_000970311.1.4812 WP_000970311.1.48176 WP_000970311.1.48226 WP_000970311.1.48258 WP_000970311.1.48697 WP_000970311.1.48712 WP_000970311.1.48792 WP_000970311.1.48806 WP_000970311.1.4931 WP_000970311.1.49332 WP_000970311.1.49401 WP_000970311.1.49464 WP_000970311.1.49496 WP_000970311.1.49567 WP_000970311.1.49655 WP_000970311.1.49771 WP_000970311.1.5003 WP_000970311.1.50110 WP_000970311.1.50345 WP_000970311.1.50358 WP_000970311.1.5037 WP_000970311.1.50380 WP_000970311.1.50549 WP_000970311.1.50762 WP_000970311.1.50986 WP_000970311.1.51154 WP_000970311.1.51171 WP_000970311.1.51505 WP_000970311.1.51643 WP_000970311.1.51693 WP_000970311.1.51834 WP_000970311.1.52039 WP_000970311.1.5217 WP_000970311.1.52496 WP_000970311.1.52543 WP_000970311.1.52883 WP_000970311.1.52933 WP_000970311.1.53084 WP_000970311.1.53181 WP_000970311.1.53211 WP_000970311.1.53252 WP_000970311.1.53270 WP_000970311.1.54024 WP_000970311.1.54213 WP_000970311.1.5441 WP_000970311.1.54454 WP_000970311.1.5467 WP_000970311.1.5486 WP_000970311.1.54883 WP_000970311.1.55218 WP_000970311.1.55286 WP_000970311.1.55492 WP_000970311.1.55820 WP_000970311.1.55838 WP_000970311.1.55892 WP_000970311.1.55897 WP_000970311.1.56072 WP_000970311.1.56151 WP_000970311.1.5639 WP_000970311.1.56392 WP_000970311.1.56481 WP_000970311.1.56489 WP_000970311.1.56554 WP_000970311.1.56571 WP_000970311.1.57032 WP_000970311.1.57068 WP_000970311.1.57071 WP_000970311.1.57180 WP_000970311.1.57197 WP_000970311.1.57280 WP_000970311.1.57453 WP_000970311.1.57466 WP_000970311.1.57610 WP_000970311.1.5764 WP_000970311.1.57646 WP_000970311.1.57836 WP_000970311.1.58048 WP_000970311.1.58057 WP_000970311.1.58169 WP_000970311.1.58238 WP_000970311.1.584 WP_000970311.1.58423 WP_000970311.1.5852 WP_000970311.1.58707 WP_000970311.1.58723 WP_000970311.1.59038 WP_000970311.1.59359 WP_000970311.1.59374 WP_000970311.1.59470 WP_000970311.1.59491 WP_000970311.1.59679 WP_000970311.1.59733 WP_000970311.1.59838 WP_000970311.1.59905 WP_000970311.1.59931 WP_000970311.1.59959 WP_000970311.1.60042 WP_000970311.1.60043 WP_000970311.1.60117 WP_000970311.1.6013 WP_000970311.1.60304 WP_000970311.1.60374 WP_000970311.1.60461 WP_000970311.1.60613 WP_000970311.1.60647 WP_000970311.1.60744 WP_000970311.1.60761 WP_000970311.1.60872 WP_000970311.1.61039 WP_000970311.1.61099 WP_000970311.1.61108 WP_000970311.1.61186 WP_000970311.1.61253 WP_000970311.1.61623 WP_000970311.1.61772 WP_000970311.1.618 WP_000970311.1.61874 WP_000970311.1.62135 WP_000970311.1.62182 WP_000970311.1.62480 WP_000970311.1.6261 WP_000970311.1.62675 WP_000970311.1.62843 WP_000970311.1.62888 WP_000970311.1.6331 WP_000970311.1.63445 WP_000970311.1.63563 WP_000970311.1.63586 WP_000970311.1.63615 WP_000970311.1.6364 WP_000970311.1.63872 WP_000970311.1.63957 WP_000970311.1.64086 WP_000970311.1.64161 WP_000970311.1.64371 WP_000970311.1.6445 WP_000970311.1.64621 WP_000970311.1.64946 WP_000970311.1.65035 WP_000970311.1.6511 WP_000970311.1.65118 WP_000970311.1.65194 WP_000970311.1.65372 WP_000970311.1.65546 WP_000970311.1.6587 WP_000970311.1.65875 WP_000970311.1.65898 WP_000970311.1.65963 WP_000970311.1.65978 WP_000970311.1.65988 WP_000970311.1.66033 WP_000970311.1.66100 WP_000970311.1.66531 WP_000970311.1.66566 WP_000970311.1.66873 WP_000970311.1.66922 WP_000970311.1.67073 WP_000970311.1.67136 WP_000970311.1.67150 WP_000970311.1.67214 WP_000970311.1.67446 WP_000970311.1.67533 WP_000970311.1.67676 WP_000970311.1.6769 WP_000970311.1.67726 WP_000970311.1.67753 WP_000970311.1.67775 WP_000970311.1.67780 WP_000970311.1.68096 WP_000970311.1.68411 WP_000970311.1.68493 WP_000970311.1.68523 WP_000970311.1.6880 WP_000970311.1.6887 WP_000970311.1.68936 WP_000970311.1.69054 WP_000970311.1.69350 WP_000970311.1.69351 WP_000970311.1.69780 WP_000970311.1.69810 WP_000970311.1.69818 WP_000970311.1.69896 WP_000970311.1.70123 WP_000970311.1.70125 WP_000970311.1.70517 WP_000970311.1.70539 WP_000970311.1.70576 WP_000970311.1.70713 WP_000970311.1.70723 WP_000970311.1.70787 WP_000970311.1.71003 WP_000970311.1.71099 WP_000970311.1.71205 WP_000970311.1.71225 WP_000970311.1.71226 WP_000970311.1.71269 WP_000970311.1.71423 WP_000970311.1.71448 WP_000970311.1.71840 WP_000970311.1.71940 WP_000970311.1.72016 WP_000970311.1.72180 WP_000970311.1.72322 WP_000970311.1.72427 WP_000970311.1.72614 WP_000970311.1.72641 WP_000970311.1.72694 WP_000970311.1.7291 WP_000970311.1.72913 WP_000970311.1.73126 WP_000970311.1.73343 WP_000970311.1.73626 WP_000970311.1.73785 WP_000970311.1.73801 WP_000970311.1.7392 WP_000970311.1.73934 WP_000970311.1.73968 WP_000970311.1.74251 WP_000970311.1.7429 WP_000970311.1.7446 WP_000970311.1.74521 WP_000970311.1.74536 WP_000970311.1.74557 WP_000970311.1.74828 WP_000970311.1.75164 WP_000970311.1.75248 WP_000970311.1.7536 WP_000970311.1.75382 WP_000970311.1.7539 WP_000970311.1.75507 WP_000970311.1.75536 WP_000970311.1.75577 WP_000970311.1.75694 WP_000970311.1.75767 WP_000970311.1.7583 WP_000970311.1.75989 WP_000970311.1.76054 WP_000970311.1.7608 WP_000970311.1.76152 WP_000970311.1.76189 WP_000970311.1.76407 WP_000970311.1.76448 WP_000970311.1.76477 WP_000970311.1.76697 WP_000970311.1.76827 WP_000970311.1.77099 WP_000970311.1.77128 WP_000970311.1.77239 WP_000970311.1.77275 WP_000970311.1.77392 WP_000970311.1.77644 WP_000970311.1.77707 WP_000970311.1.77760 WP_000970311.1.77961 WP_000970311.1.77979 WP_000970311.1.7799 WP_000970311.1.78063 WP_000970311.1.784 WP_000970311.1.7855 WP_000970311.1.78593 WP_000970311.1.78611 WP_000970311.1.79172 WP_000970311.1.7940 WP_000970311.1.79528 WP_000970311.1.79563 WP_000970311.1.79576 WP_000970311.1.79715 WP_000970311.1.79965 WP_000970311.1.80309 WP_000970311.1.80330 WP_000970311.1.80578 WP_000970311.1.80606 WP_000970311.1.81070 WP_000970311.1.81160 WP_000970311.1.81420 WP_000970311.1.81442 WP_000970311.1.81514 WP_000970311.1.81754 WP_000970311.1.81821 WP_000970311.1.81873 WP_000970311.1.81934 WP_000970311.1.81975 WP_000970311.1.82010 WP_000970311.1.82057 WP_000970311.1.82296 WP_000970311.1.82594 WP_000970311.1.82629 WP_000970311.1.8268 WP_000970311.1.82797 WP_000970311.1.82820 WP_000970311.1.83099 WP_000970311.1.83712 WP_000970311.1.84219 WP_000970311.1.84264 WP_000970311.1.84312 WP_000970311.1.84482 WP_000970311.1.84635 WP_000970311.1.84657 WP_000970311.1.8477 WP_000970311.1.85253 WP_000970311.1.85558 WP_000970311.1.85722 WP_000970311.1.85772 WP_000970311.1.86105 WP_000970311.1.86225 WP_000970311.1.86255 WP_000970311.1.86340 WP_000970311.1.86574 WP_000970311.1.86994 WP_000970311.1.87076 WP_000970311.1.87247 WP_000970311.1.87254 WP_000970311.1.87382 WP_000970311.1.87616 WP_000970311.1.88197 WP_000970311.1.8843 WP_000970311.1.88524 WP_000970311.1.88528 WP_000970311.1.88803 WP_000970311.1.88891 WP_000970311.1.89322 WP_000970311.1.89569 WP_000970311.1.89781 WP_000970311.1.89852 WP_000970311.1.89959 WP_000970311.1.89988 WP_000970311.1.90139 WP_000970311.1.90219 WP_000970311.1.90257 WP_000970311.1.90342 WP_000970311.1.90349 WP_000970311.1.90837 WP_000970311.1.90848 WP_000970311.1.90967 WP_000970311.1.9098 WP_000970311.1.90997 WP_000970311.1.91072 WP_000970311.1.91088 WP_000970311.1.91153 WP_000970311.1.91288 WP_000970311.1.91356 WP_000970311.1.91384 WP_000970311.1.91548 WP_000970311.1.91651 WP_000970311.1.9168 WP_000970311.1.91801 WP_000970311.1.91871 WP_000970311.1.92819 WP_000970311.1.93027 WP_000970311.1.93069 WP_000970311.1.93427 WP_000970311.1.93428 WP_000970311.1.93601 WP_000970311.1.93630 WP_000970311.1.93670 WP_000970311.1.93695 WP_000970311.1.93821 WP_000970311.1.94213 WP_000970311.1.9426 WP_000970311.1.94302 WP_000970311.1.94343 WP_000970311.1.94544 WP_000970311.1.94589 WP_000970311.1.94676 WP_000970311.1.94790 WP_000970311.1.94991 WP_000970311.1.95011 WP_000970311.1.95028 WP_000970311.1.95035 WP_000970311.1.95129 WP_000970311.1.95834 WP_000970311.1.9616 WP_000970311.1.96425 WP_000970311.1.96450 WP_000970311.1.96480 WP_000970311.1.96725 WP_000970311.1.96796 WP_000970311.1.97193 WP_000970311.1.9729 WP_000970311.1.9740 WP_000970311.1.97402 WP_000970311.1.97513 WP_000970311.1.97632 WP_000970311.1.9770 WP_000970311.1.97789 WP_000970311.1.97871 WP_000970311.1.98046 WP_000970311.1.98083 WP_000970311.1.981 WP_000970311.1.98155 WP_000970311.1.98176 WP_000970311.1.98187 WP_000970311.1.98205 WP_000970311.1.98279 WP_000970311.1.98312 WP_000970311.1.98384 WP_000970311.1.98543 WP_000970311.1.9883 WP_000970311.1.98920 WP_000970311.1.99101 WP_000970311.1.99182 WP_000970311.1.99234 WP_000970311.1.99487 WP_000970311.1.99501 WP_000970311.1.99692 WP_000970311.1.99986 gi|387505513|ref|YP_006157769.1| gi|15800225|ref|NP_286237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]