SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15803622|ref|NP_289655.1| from Escherichia coli O157:H7 str. EDL933

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15803622|ref|NP_289655.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.3e-109
Family FMN-linked oxidoreductases 0.0000000000108
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.59e-42
Family N-terminal domain of adrenodoxin reductase-like 0.000000312
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.56e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000583
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15803622|ref|NP_289655.1|
Sequence length 672
Comment NADPH dehydrogenase [Escherichia coli O157:H7 str. EDL933]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFARCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYHNRMRFAVEVVSAVRERVGNDFIIIYRLSMLDLVEGGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAMQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRTPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAGFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A0F6C954 A0A0F6FCE5 A0A0H3PTL4 A0A1Z3UZE6 A0A2H1BAY3 C3STT3 D3QS26 Q8XAL0
NP_311990.1.58667 WP_000121479.1.10001 WP_000121479.1.100073 WP_000121479.1.10010 WP_000121479.1.100299 WP_000121479.1.100302 WP_000121479.1.100508 WP_000121479.1.100554 WP_000121479.1.100925 WP_000121479.1.101105 WP_000121479.1.101166 WP_000121479.1.101206 WP_000121479.1.101628 WP_000121479.1.10206 WP_000121479.1.102094 WP_000121479.1.102139 WP_000121479.1.10273 WP_000121479.1.10335 WP_000121479.1.10476 WP_000121479.1.10761 WP_000121479.1.10970 WP_000121479.1.1111 WP_000121479.1.11240 WP_000121479.1.11301 WP_000121479.1.11420 WP_000121479.1.11671 WP_000121479.1.11690 WP_000121479.1.12259 WP_000121479.1.12305 WP_000121479.1.12552 WP_000121479.1.13060 WP_000121479.1.13223 WP_000121479.1.13332 WP_000121479.1.13348 WP_000121479.1.13430 WP_000121479.1.13442 WP_000121479.1.13481 WP_000121479.1.13881 WP_000121479.1.13936 WP_000121479.1.13939 WP_000121479.1.14110 WP_000121479.1.14453 WP_000121479.1.14621 WP_000121479.1.14748 WP_000121479.1.15356 WP_000121479.1.15503 WP_000121479.1.15527 WP_000121479.1.15626 WP_000121479.1.15702 WP_000121479.1.15782 WP_000121479.1.16075 WP_000121479.1.16133 WP_000121479.1.16222 WP_000121479.1.16272 WP_000121479.1.16463 WP_000121479.1.16481 WP_000121479.1.17187 WP_000121479.1.17415 WP_000121479.1.17515 WP_000121479.1.17904 WP_000121479.1.18112 WP_000121479.1.18136 WP_000121479.1.18326 WP_000121479.1.1834 WP_000121479.1.18340 WP_000121479.1.1881 WP_000121479.1.18837 WP_000121479.1.18995 WP_000121479.1.19039 WP_000121479.1.191 WP_000121479.1.19140 WP_000121479.1.19350 WP_000121479.1.19419 WP_000121479.1.19840 WP_000121479.1.19847 WP_000121479.1.2005 WP_000121479.1.20264 WP_000121479.1.20449 WP_000121479.1.20546 WP_000121479.1.20594 WP_000121479.1.20745 WP_000121479.1.20893 WP_000121479.1.20941 WP_000121479.1.20950 WP_000121479.1.20989 WP_000121479.1.21508 WP_000121479.1.21666 WP_000121479.1.21668 WP_000121479.1.21962 WP_000121479.1.2218 WP_000121479.1.22251 WP_000121479.1.22304 WP_000121479.1.22381 WP_000121479.1.22594 WP_000121479.1.22925 WP_000121479.1.23073 WP_000121479.1.23115 WP_000121479.1.23241 WP_000121479.1.23323 WP_000121479.1.23467 WP_000121479.1.23790 WP_000121479.1.23806 WP_000121479.1.23838 WP_000121479.1.2388 WP_000121479.1.23895 WP_000121479.1.23899 WP_000121479.1.23973 WP_000121479.1.23984 WP_000121479.1.24070 WP_000121479.1.24283 WP_000121479.1.24341 WP_000121479.1.24753 WP_000121479.1.24870 WP_000121479.1.25076 WP_000121479.1.25082 WP_000121479.1.25088 WP_000121479.1.25201 WP_000121479.1.25305 WP_000121479.1.25526 WP_000121479.1.25577 WP_000121479.1.25794 WP_000121479.1.25819 WP_000121479.1.25831 WP_000121479.1.26066 WP_000121479.1.26105 WP_000121479.1.26121 WP_000121479.1.26134 WP_000121479.1.26246 WP_000121479.1.26474 WP_000121479.1.26525 WP_000121479.1.26761 WP_000121479.1.26878 WP_000121479.1.26975 WP_000121479.1.26998 WP_000121479.1.27338 WP_000121479.1.27445 WP_000121479.1.28143 WP_000121479.1.28551 WP_000121479.1.28734 WP_000121479.1.28879 WP_000121479.1.291 WP_000121479.1.29126 WP_000121479.1.29404 WP_000121479.1.29564 WP_000121479.1.29597 WP_000121479.1.29618 WP_000121479.1.2978 WP_000121479.1.29818 WP_000121479.1.29976 WP_000121479.1.30 WP_000121479.1.30019 WP_000121479.1.30052 WP_000121479.1.30064 WP_000121479.1.30164 WP_000121479.1.30476 WP_000121479.1.30918 WP_000121479.1.30993 WP_000121479.1.30999 WP_000121479.1.31055 WP_000121479.1.312 WP_000121479.1.31252 WP_000121479.1.3140 WP_000121479.1.31401 WP_000121479.1.31575 WP_000121479.1.31715 WP_000121479.1.31956 WP_000121479.1.32063 WP_000121479.1.322 WP_000121479.1.32243 WP_000121479.1.32536 WP_000121479.1.32574 WP_000121479.1.32590 WP_000121479.1.32888 WP_000121479.1.32931 WP_000121479.1.33049 WP_000121479.1.33055 WP_000121479.1.33094 WP_000121479.1.33125 WP_000121479.1.33146 WP_000121479.1.33167 WP_000121479.1.33178 WP_000121479.1.33268 WP_000121479.1.33981 WP_000121479.1.34224 WP_000121479.1.34269 WP_000121479.1.34383 WP_000121479.1.34500 WP_000121479.1.34680 WP_000121479.1.34686 WP_000121479.1.35393 WP_000121479.1.3550 WP_000121479.1.36010 WP_000121479.1.36212 WP_000121479.1.37102 WP_000121479.1.37337 WP_000121479.1.37372 WP_000121479.1.3762 WP_000121479.1.37731 WP_000121479.1.37769 WP_000121479.1.3795 WP_000121479.1.38050 WP_000121479.1.38063 WP_000121479.1.38306 WP_000121479.1.38369 WP_000121479.1.38835 WP_000121479.1.389 WP_000121479.1.38958 WP_000121479.1.39180 WP_000121479.1.39268 WP_000121479.1.39310 WP_000121479.1.39415 WP_000121479.1.39564 WP_000121479.1.39601 WP_000121479.1.39646 WP_000121479.1.39820 WP_000121479.1.40113 WP_000121479.1.40234 WP_000121479.1.4030 WP_000121479.1.40549 WP_000121479.1.40629 WP_000121479.1.40742 WP_000121479.1.40758 WP_000121479.1.40793 WP_000121479.1.40882 WP_000121479.1.40900 WP_000121479.1.40952 WP_000121479.1.4103 WP_000121479.1.41060 WP_000121479.1.41294 WP_000121479.1.41330 WP_000121479.1.41478 WP_000121479.1.41536 WP_000121479.1.41734 WP_000121479.1.41849 WP_000121479.1.42036 WP_000121479.1.4213 WP_000121479.1.42447 WP_000121479.1.4250 WP_000121479.1.42513 WP_000121479.1.42594 WP_000121479.1.4261 WP_000121479.1.42863 WP_000121479.1.42975 WP_000121479.1.43013 WP_000121479.1.43079 WP_000121479.1.43121 WP_000121479.1.4313 WP_000121479.1.43140 WP_000121479.1.43196 WP_000121479.1.43384 WP_000121479.1.43448 WP_000121479.1.43469 WP_000121479.1.43536 WP_000121479.1.43754 WP_000121479.1.43798 WP_000121479.1.43816 WP_000121479.1.43837 WP_000121479.1.43911 WP_000121479.1.43939 WP_000121479.1.44125 WP_000121479.1.44165 WP_000121479.1.44203 WP_000121479.1.44389 WP_000121479.1.44488 WP_000121479.1.44561 WP_000121479.1.44733 WP_000121479.1.44906 WP_000121479.1.44954 WP_000121479.1.45020 WP_000121479.1.45153 WP_000121479.1.45195 WP_000121479.1.45293 WP_000121479.1.45404 WP_000121479.1.45575 WP_000121479.1.45707 WP_000121479.1.45841 WP_000121479.1.45901 WP_000121479.1.45941 WP_000121479.1.46039 WP_000121479.1.46282 WP_000121479.1.46283 WP_000121479.1.46369 WP_000121479.1.46414 WP_000121479.1.46451 WP_000121479.1.46597 WP_000121479.1.46611 WP_000121479.1.46626 WP_000121479.1.46810 WP_000121479.1.46832 WP_000121479.1.46913 WP_000121479.1.4708 WP_000121479.1.47140 WP_000121479.1.4723 WP_000121479.1.47411 WP_000121479.1.47784 WP_000121479.1.47827 WP_000121479.1.47884 WP_000121479.1.47954 WP_000121479.1.47994 WP_000121479.1.48065 WP_000121479.1.4812 WP_000121479.1.48176 WP_000121479.1.48226 WP_000121479.1.48258 WP_000121479.1.48697 WP_000121479.1.48712 WP_000121479.1.48792 WP_000121479.1.48806 WP_000121479.1.4931 WP_000121479.1.49332 WP_000121479.1.49401 WP_000121479.1.49464 WP_000121479.1.49496 WP_000121479.1.49567 WP_000121479.1.49655 WP_000121479.1.49771 WP_000121479.1.5003 WP_000121479.1.50110 WP_000121479.1.50345 WP_000121479.1.50358 WP_000121479.1.5037 WP_000121479.1.50380 WP_000121479.1.50549 WP_000121479.1.50762 WP_000121479.1.50986 WP_000121479.1.51154 WP_000121479.1.51171 WP_000121479.1.51505 WP_000121479.1.51643 WP_000121479.1.51693 WP_000121479.1.51834 WP_000121479.1.52039 WP_000121479.1.5217 WP_000121479.1.52496 WP_000121479.1.52543 WP_000121479.1.52883 WP_000121479.1.52933 WP_000121479.1.53084 WP_000121479.1.53181 WP_000121479.1.53211 WP_000121479.1.53252 WP_000121479.1.53270 WP_000121479.1.54024 WP_000121479.1.54213 WP_000121479.1.5441 WP_000121479.1.54454 WP_000121479.1.5467 WP_000121479.1.5486 WP_000121479.1.54883 WP_000121479.1.55218 WP_000121479.1.55286 WP_000121479.1.55492 WP_000121479.1.55820 WP_000121479.1.55838 WP_000121479.1.55892 WP_000121479.1.55897 WP_000121479.1.56072 WP_000121479.1.5639 WP_000121479.1.56392 WP_000121479.1.56481 WP_000121479.1.56489 WP_000121479.1.56491 WP_000121479.1.56571 WP_000121479.1.57032 WP_000121479.1.57068 WP_000121479.1.57071 WP_000121479.1.57180 WP_000121479.1.57197 WP_000121479.1.57280 WP_000121479.1.57453 WP_000121479.1.57466 WP_000121479.1.57610 WP_000121479.1.5764 WP_000121479.1.57646 WP_000121479.1.57836 WP_000121479.1.58048 WP_000121479.1.58057 WP_000121479.1.58238 WP_000121479.1.58423 WP_000121479.1.5852 WP_000121479.1.58707 WP_000121479.1.58723 WP_000121479.1.59374 WP_000121479.1.59470 WP_000121479.1.59491 WP_000121479.1.59679 WP_000121479.1.59733 WP_000121479.1.59838 WP_000121479.1.59905 WP_000121479.1.59959 WP_000121479.1.60042 WP_000121479.1.60043 WP_000121479.1.60117 WP_000121479.1.6013 WP_000121479.1.60304 WP_000121479.1.60374 WP_000121479.1.60461 WP_000121479.1.60613 WP_000121479.1.60647 WP_000121479.1.60744 WP_000121479.1.60761 WP_000121479.1.60872 WP_000121479.1.60935 WP_000121479.1.61039 WP_000121479.1.61099 WP_000121479.1.61108 WP_000121479.1.61186 WP_000121479.1.61253 WP_000121479.1.61623 WP_000121479.1.618 WP_000121479.1.61874 WP_000121479.1.62135 WP_000121479.1.62182 WP_000121479.1.62480 WP_000121479.1.6261 WP_000121479.1.62675 WP_000121479.1.62888 WP_000121479.1.6331 WP_000121479.1.63445 WP_000121479.1.63563 WP_000121479.1.63586 WP_000121479.1.63615 WP_000121479.1.6364 WP_000121479.1.63872 WP_000121479.1.63957 WP_000121479.1.64086 WP_000121479.1.64161 WP_000121479.1.64371 WP_000121479.1.6445 WP_000121479.1.64621 WP_000121479.1.64946 WP_000121479.1.65035 WP_000121479.1.65084 WP_000121479.1.6511 WP_000121479.1.65194 WP_000121479.1.65372 WP_000121479.1.6587 WP_000121479.1.65875 WP_000121479.1.65898 WP_000121479.1.65963 WP_000121479.1.65978 WP_000121479.1.66033 WP_000121479.1.66100 WP_000121479.1.66531 WP_000121479.1.66566 WP_000121479.1.66873 WP_000121479.1.66922 WP_000121479.1.67073 WP_000121479.1.67136 WP_000121479.1.67150 WP_000121479.1.67214 WP_000121479.1.67446 WP_000121479.1.67533 WP_000121479.1.67676 WP_000121479.1.6769 WP_000121479.1.67726 WP_000121479.1.67753 WP_000121479.1.67775 WP_000121479.1.67780 WP_000121479.1.68096 WP_000121479.1.68411 WP_000121479.1.68493 WP_000121479.1.68523 WP_000121479.1.6880 WP_000121479.1.6887 WP_000121479.1.68936 WP_000121479.1.69054 WP_000121479.1.69350 WP_000121479.1.69351 WP_000121479.1.69780 WP_000121479.1.69810 WP_000121479.1.69818 WP_000121479.1.69896 WP_000121479.1.70123 WP_000121479.1.70125 WP_000121479.1.70517 WP_000121479.1.70539 WP_000121479.1.70576 WP_000121479.1.70713 WP_000121479.1.70723 WP_000121479.1.70787 WP_000121479.1.71003 WP_000121479.1.71099 WP_000121479.1.71205 WP_000121479.1.71225 WP_000121479.1.71226 WP_000121479.1.71269 WP_000121479.1.71423 WP_000121479.1.71448 WP_000121479.1.71840 WP_000121479.1.72016 WP_000121479.1.72180 WP_000121479.1.72322 WP_000121479.1.72427 WP_000121479.1.72614 WP_000121479.1.72641 WP_000121479.1.72694 WP_000121479.1.7291 WP_000121479.1.72913 WP_000121479.1.73126 WP_000121479.1.73343 WP_000121479.1.73626 WP_000121479.1.73785 WP_000121479.1.73801 WP_000121479.1.7392 WP_000121479.1.73934 WP_000121479.1.73968 WP_000121479.1.74251 WP_000121479.1.7429 WP_000121479.1.74521 WP_000121479.1.74536 WP_000121479.1.74557 WP_000121479.1.74828 WP_000121479.1.74904 WP_000121479.1.75164 WP_000121479.1.75248 WP_000121479.1.7536 WP_000121479.1.7539 WP_000121479.1.75507 WP_000121479.1.75536 WP_000121479.1.75577 WP_000121479.1.75694 WP_000121479.1.7583 WP_000121479.1.75989 WP_000121479.1.76054 WP_000121479.1.7608 WP_000121479.1.76152 WP_000121479.1.76189 WP_000121479.1.76407 WP_000121479.1.76448 WP_000121479.1.76477 WP_000121479.1.76697 WP_000121479.1.76827 WP_000121479.1.77099 WP_000121479.1.77128 WP_000121479.1.77239 WP_000121479.1.77275 WP_000121479.1.77392 WP_000121479.1.77644 WP_000121479.1.77760 WP_000121479.1.77961 WP_000121479.1.77979 WP_000121479.1.7799 WP_000121479.1.784 WP_000121479.1.7855 WP_000121479.1.78593 WP_000121479.1.78611 WP_000121479.1.79172 WP_000121479.1.7940 WP_000121479.1.79528 WP_000121479.1.79563 WP_000121479.1.79576 WP_000121479.1.79715 WP_000121479.1.79965 WP_000121479.1.80309 WP_000121479.1.80330 WP_000121479.1.80578 WP_000121479.1.80606 WP_000121479.1.81070 WP_000121479.1.81273 WP_000121479.1.81420 WP_000121479.1.81442 WP_000121479.1.81514 WP_000121479.1.81754 WP_000121479.1.81821 WP_000121479.1.81873 WP_000121479.1.81934 WP_000121479.1.81975 WP_000121479.1.82010 WP_000121479.1.82057 WP_000121479.1.82296 WP_000121479.1.82594 WP_000121479.1.82629 WP_000121479.1.8268 WP_000121479.1.82797 WP_000121479.1.82820 WP_000121479.1.83712 WP_000121479.1.84219 WP_000121479.1.84264 WP_000121479.1.84312 WP_000121479.1.84482 WP_000121479.1.84635 WP_000121479.1.84657 WP_000121479.1.8477 WP_000121479.1.85253 WP_000121479.1.85558 WP_000121479.1.85722 WP_000121479.1.85772 WP_000121479.1.86105 WP_000121479.1.86171 WP_000121479.1.86225 WP_000121479.1.86255 WP_000121479.1.86340 WP_000121479.1.86574 WP_000121479.1.86994 WP_000121479.1.87076 WP_000121479.1.87247 WP_000121479.1.87254 WP_000121479.1.87382 WP_000121479.1.87616 WP_000121479.1.88197 WP_000121479.1.8843 WP_000121479.1.88524 WP_000121479.1.88528 WP_000121479.1.88891 WP_000121479.1.89322 WP_000121479.1.89385 WP_000121479.1.89405 WP_000121479.1.89569 WP_000121479.1.89852 WP_000121479.1.89959 WP_000121479.1.89988 WP_000121479.1.90139 WP_000121479.1.90219 WP_000121479.1.90257 WP_000121479.1.90342 WP_000121479.1.90349 WP_000121479.1.90837 WP_000121479.1.90848 WP_000121479.1.90967 WP_000121479.1.9098 WP_000121479.1.91072 WP_000121479.1.91088 WP_000121479.1.91153 WP_000121479.1.91356 WP_000121479.1.91384 WP_000121479.1.91548 WP_000121479.1.91651 WP_000121479.1.9168 WP_000121479.1.91801 WP_000121479.1.91871 WP_000121479.1.92819 WP_000121479.1.93027 WP_000121479.1.93427 WP_000121479.1.93601 WP_000121479.1.93630 WP_000121479.1.93670 WP_000121479.1.93695 WP_000121479.1.93821 WP_000121479.1.94213 WP_000121479.1.9426 WP_000121479.1.94302 WP_000121479.1.94343 WP_000121479.1.94544 WP_000121479.1.94589 WP_000121479.1.94676 WP_000121479.1.94790 WP_000121479.1.94991 WP_000121479.1.95011 WP_000121479.1.95028 WP_000121479.1.95035 WP_000121479.1.95129 WP_000121479.1.95834 WP_000121479.1.9616 WP_000121479.1.96425 WP_000121479.1.96480 WP_000121479.1.96725 WP_000121479.1.96796 WP_000121479.1.97193 WP_000121479.1.9729 WP_000121479.1.9740 WP_000121479.1.97402 WP_000121479.1.97513 WP_000121479.1.97632 WP_000121479.1.97789 WP_000121479.1.97871 WP_000121479.1.98046 WP_000121479.1.981 WP_000121479.1.98155 WP_000121479.1.98176 WP_000121479.1.98187 WP_000121479.1.98205 WP_000121479.1.98279 WP_000121479.1.98312 WP_000121479.1.98384 WP_000121479.1.98543 WP_000121479.1.98569 WP_000121479.1.9883 WP_000121479.1.98920 WP_000121479.1.99101 WP_000121479.1.99182 WP_000121479.1.99234 WP_000121479.1.99487 WP_000121479.1.99501 WP_000121479.1.99692 WP_000121479.1.99986 gi|15833217|ref|NP_311990.1| gi|387884268|ref|YP_006314570.1| 155864.Z4434 386585.ECs3963 444450.ECH74115_4395 544404.ECSP_4055 gi|387508487|ref|YP_006160743.1| gi|15803622|ref|NP_289655.1| gi|254795032|ref|YP_003079869.1| gi|209399199|ref|YP_002272554.1| gi|291284459|ref|YP_003501277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]