SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91210427|ref|YP_540413.1| from Escherichia coli UTI89

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91210427|ref|YP_540413.1|
Domain Number 1 Region: 452-557
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000106
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|91210427|ref|YP_540413.1|
Sequence length 559
Comment sulfate transporter YchM [Escherichia coli UTI89]
Sequence
MNKIFSSHVMPFRALIDACWKEKYTAARFTRDLIAGITVGIIAIPLAMALAIGSGVAPQY
GLYTAAVAGIVIALTGGARFSVSGPTAAFVVILYPVSQQFGLAGLLVATLLSGIFLILMG
LARFGRLIEYIPVSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALFMALPT
INVGDAAIGIVTLGILVFWPRLGIRLPGHLPALLAGCAVMGIVNLLGGHVATIGSQFHYV
LADGSQGNGIPQLLPQLVLPWDLPNSEFTLTWDSIRTLLPAAFSMAMLGAIESLLCAVVL
DGMTGTKHKANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPISAVIHSILV
ILALLVLAPLLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVMLLCMSLTVL
FDMVIAISVGIVLASLLFMRRIARMTRLAPVVVDVPDDVLVLRVIGPLFFAAAEGLFTDL
ESRLEGKRIVILKWDAVPVLDAGGLDAFQRFVKRLPEGCELRVCNLEFQPLRTMARAGIQ
PIPGRLAFFPNRRAAMADL
Download sequence
Identical sequences A0A2I6KPU6 Q1RCN2
WP_001033330.1.16799 WP_001033330.1.54388 WP_001033330.1.68735 WP_001033330.1.744 WP_001033330.1.9420 364106.UTI89_C1400 gi|91210427|ref|YP_540413.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]