SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000002557 from Echinops telfairi 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000002557
Domain Number 1 Region: 631-823
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 107-261
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-37
Family DBL homology domain (DH-domain) 0.00069
Further Details:      
 
Domain Number 3 Region: 277-346,404-438
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-20
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 4 Region: 481-587
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000234
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000002557   Gene: ENSETEG00000003119   Transcript: ENSETET00000003119
Sequence length 835
Comment pep:novel genescaffold:TENREC:GeneScaffold_7271:131145:302599:-1 gene:ENSETEG00000003119 transcript:ENSETET00000003119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSYGAEDYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGSGDRISPIPPEGLAP
GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMKPLKATATSQPVLTIQQIETIFYK
IQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCS
QSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPADHP
DYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVEVSESSRKLRHVF
LFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKM
KISALKSEIQKEKANKGQGRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLS
SDYERSEWREAIQKLQKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDESPGL
YGFLHVIVHSAKGFKQSANLYCTLEMDSFGYFVSKAKTRVFRDTTEPKWDEEFEIELEGS
QSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHADTIEMNGIKVEF
SMKFTSQDMSLKRTSSIQTGVFGLKITEVTRERSKVPYIVRQCVEEVEKRGIEEVGIYRI
SGVATDIQALKAVFDAXXXXXXXXXXXXXXXXXXXTLKLYFRELPEPLLTDRLYPAFMEG
IALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTL
LRPSEMESKVQLTSAADIWSHDVMAQVQVLLYYLQHPPISFSELKRNTLYFSTDV
Download sequence
Identical sequences ENSETEP00000002557 ENSETEP00000002557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]