SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000003286 from Echinops telfairi 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000003286
Domain Number 1 Region: 42-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.17e-32
Family SCAN domain 0.0001
Further Details:      
 
Domain Number 2 Region: 307-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-21
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 3 Region: 265-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 348-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 138-185
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-16
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000003286   Gene: ENSETEG00000004012   Transcript: ENSETET00000004008
Sequence length 415
Comment pep:novel scaffold:TENREC:scaffold_291745:49640:58593:-1 gene:ENSETEG00000004012 transcript:ENSETET00000004008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMGDLEVAAGWIPKLRPRVGLKGPVKHTSNQGEKFTPLSNSLDPENSRQHFRNFFYPEA
APPLQVVNQLQELCRQWLRPESHSKEQILEMLLLEQFLAILPREFQSQMQKHHPQSIQEA
VALVDLFRGEFDPGRKESLLTFEDVSFNFSQEEWELLDVNQKALYNSVMQDTYETVISLG
LKIRNYPVNDQPVPAAELEIQAPGGRVSKKAKMDTPQKTTGTENRGGIFRVRKRHRNCPG
RKRKKHSTCKQDVPKCTDLQKKGPSGEKPFKCQECGKSFRVSSDLIKHQRIHTEEKPYRC
QQCDRRFRWSSDLNKHLMTHQGIKPHKCSWCGKSFSHNTNLHTHQRIHTGEKPFKCHECG
KRFIQNSHLIKHQRTHTGEQPYSCSTCKRNFSRRSSLVRHQKLHRPREDCPVAPV
Download sequence
Identical sequences ENSETEP00000003286 ENSETEP00000003286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]