SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000004318 from Echinops telfairi 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000004318
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.05e-44
Family G proteins 0.0000197
Further Details:      
 
Domain Number 2 Region: 189-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000785
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000004318   Gene: ENSETEG00000005311   Transcript: ENSETET00000005309
Sequence length 281
Comment pep:novel genescaffold:TENREC:GeneScaffold_8320:5579:15535:1 gene:ENSETEG00000005311 transcript:ENSETET00000005309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGASESPYAYSNGIDYKTTTILLDG
RRVKLEIWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIREIDEHAPGVP
RILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVTESFTELSRIVLMRHGM
EKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRS
YSLAGGGGGGGSKGSSLKRSRSIRPPQSPPQNCSRSNCKIS
Download sequence
Identical sequences ENSETEP00000004318 ENSETEP00000004318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]