SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000006702 from Echinops telfairi 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000006702
Domain Number 1 Region: 39-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-34
Family SCAN domain 0.0000888
Further Details:      
 
Domain Number 2 Region: 455-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 370-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 157-202
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-18
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 339-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000268
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000006702   Gene: ENSETEG00000008248   Transcript: ENSETET00000008247
Sequence length 512
Comment pep:novel genescaffold:TENREC:GeneScaffold_4932:4082:13389:1 gene:ENSETEG00000008248 transcript:ENSETET00000008247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLKRLMAILKPQNLAVCEKSEVLNWQKEDIPVMEICDSEASRRKFRQFQYLEMATPHE
SLSQLWELCLQWLKPEIHTKSQIVELLVLEQFLTVVPEEVRTWVNLQHPENSKEIVTLME
DMFDMLKDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQVTFKDVTVEFSEEEWGQLGPD
VKNLYRDVMLENYRNLSSLGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQRISGGE
QSSHEVIVPNRLSSVDAWKEDGWVYGNQENQDMHLPQETYIPKIIPTEEQDFTCTKYEES
INLKSVNSINNVQQRIPKRKGSPKCDKLKINFKFNVYSVGKQPSEFNKYGKPLNQSTDTI
QHQKTETTKKSYECFQCGKAFSRSSSLIRHQITHTGEKPYKCHECGRFFNRRTNLTKHQK
IHTEIQLSEGNRHGDTSRKNEDCDQNPTLHSRGNPFECADCGKSFTRNSSLTRHKMIHTG
EKPFKCEECEKTFNRTSNLTKHQQLHICEKYY
Download sequence
Identical sequences ENSETEP00000006702 ENSETEP00000006702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]