SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000013355 from Echinops telfairi 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000013355
Domain Number 1 Region: 61-280
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-50
Family YWTD domain 0.00000253
Further Details:      
 
Domain Number 2 Region: 331-570
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-50
Family YWTD domain 0.00000321
Further Details:      
 
Domain Number 3 Region: 632-818
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-34
Family YWTD domain 0.0000505
Further Details:      
 
Domain Number 4 Region: 935-1078,1135-1183
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-23
Family YWTD domain 0.00038
Further Details:      
 
Domain Number 5 Region: 889-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000887
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 1326-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000115
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1247-1287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 9 Region: 1288-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000152
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1205-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000542
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000013355   Gene: ENSETEG00000016460   Transcript: ENSETET00000016462
Sequence length 1614
Comment pep:novel genescaffold:TENREC:GeneScaffold_2881:62899:182348:-1 gene:ENSETEG00000016460 transcript:ENSETET00000016462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVLRSLLACSFCVLLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFVF
GHGLVYWSDVSEEAIKRTEFTKTESVQNVVVSGLLSPDGIACDWLGEKLYWTDSESNRIE
VSNLDGSLRKVLYWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSTRFVIINTN
IYWPNGLTVDYEEQKLYWADAKLNFIHKANVDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGESLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCRNGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRTFLDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPVIGYMYWTDWGEIPKIERAAMDGSD
RVVLVNTSLGWPNGLALDYDEHKIYWGDAKTDKIEVINTDGSGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDXXXXXXXXXXXXXXXXTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRASMDG
SERTTLVPNVGRANGLTIDYTKRRLYWTDLDTNLIESSNMLXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNTDNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEILQPYDL
SIDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGDQDRPRAIVVNPEKGYMYFTNLQEX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANRIVV
EDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNL
QEFRQHPCTQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTG
EIDCIPVAWRSDGFTECEDHSDELNCPVCSESQCQCASGQCIEGALRCNGDANCQDKSDE
KNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCGDKSDELDCYPTEEPAPQPTNTVGSVIG
VIVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHASSLSASLPGM
SRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYT
MEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSD
LNYDSEPVPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences ENSETEP00000013355 ENSETEP00000013355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]