SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005931 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005931
Domain Number 1 Region: 210-293
Classification Level Classification E-value
Superfamily E set domains 2.43e-19
Family E-set domains of sugar-utilizing enzymes 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005931   Gene: ENSEEUG00000006485   Transcript: ENSEEUT00000006496
Sequence length 467
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1101:4770:58018:1 gene:ENSEEUG00000006485 transcript:ENSEEUT00000006496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVGLARAHFEKQPPSNLRKSNFFHFVLAMYDRQGQPVEVERTAFIDFVEKDREPGAEKTN
NGIHYRLRLVYNNGLRTEQDLYVRLIDSMSKQXXXXXXXXXXXXXXXXXXXXXXXXXRCC
DRKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVSVDGHV
LAVSDNMFVHNNSKHGRRARRLDPSEAATPCIKAISPGEGWTTGGATVIVIGDNFFDGLQ
VVFGNVLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELLLKRAADVAEALY
SAPRAPAPLGPLAPSHPHPAVVGINAFSTPLAIAVGDATPGPEPGYARSCSSTSPRGFAP
SPGSQQSSYGGGLGAGLGGYGAQGVAGLGVPGSPSFLNGSTATSPFA
Download sequence
Identical sequences ENSEEUP00000005931 ENSEEUP00000005931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]