SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000648 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000648
Domain Number 1 Region: 26-282
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.5e-37
Family AAT-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000648   Gene: ENSEEUG00000000732   Transcript: ENSEEUT00000000732
Sequence length 283
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8382:10106:11560:1 gene:ENSEEUG00000000732 transcript:ENSEEUT00000000732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARAGGHSQAAMNGMKEKVLTLDTMNPCVRRVEYAVRGPIVLRALELEQDLRQGVKKPF
TEIIHANLGDAQAMGQKTITFFRQVLALCVHPDLLNSPHFPEDTKRRAERILQACGGHSL
GAYTFSAGIRLFREDVAQYIEQRDGGIPSDPNNIFLSTGASDAIMTVLKLLVAGEGRSRT
GVLIPIPQYPLYSAVLAEFNAVQVDYYLDEDRAWALDIAELQRALHEARGHCTPRALCII
NPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYADG
Download sequence
Identical sequences ENSEEUP00000000648 ENSEEUP00000000648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]