SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000655 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000655
Domain Number 1 Region: 86-513
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.97e-46
Family AAT-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000655   Gene: ENSEEUG00000000739   Transcript: ENSEEUT00000000739
Sequence length 522
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6445:47967:91636:1 gene:ENSEEUG00000000739 transcript:ENSEEUT00000000739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRAAALVQRAYRPRTPCPWSRCQSSAAAEASAVLKMRPERSQRERILTLESMNPQVKAV
EYAVRGPIVLKAGEIEMELRRGIKKPFTEVIRANIGDAHAMGQQPITFLRQVMALCTYPN
LLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGVPADPDNI
YLTTGASDGITTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAVQVNYYLDEENCW
ALNVNELRRALREAKEHCDPKVLCIINPGNPTXXXXXXXXXXXXXXXXXXXXXXXXXXXV
YQDNVYSLDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGXXXXXXXXXXXXXXXX
XXXXXXXXXXSVRLCPPVSGQAAMDIVVNPPVPGEESFEQFSREKESVLGNLAKKAKLTE
DLFNQVPGIHCNPLQGAMYAFPRIFIPTKAMEAAQAHKMAPDMFYCMKLLEETGICVVPG
SGFGQREGTYHFRMTILPPVEKLKTVLEKVKDFHINFLEKYA
Download sequence
Identical sequences ENSEEUP00000000655 ENSEEUP00000000655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]