SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001886 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001886
Domain Number 1 Region: 29-459
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.14e-58
Family Cystathionine synthase-like 0.0000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001886   Gene: ENSEEUG00000002067   Transcript: ENSEEUT00000002068
Sequence length 465
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2591:798:82312:1 gene:ENSEEUG00000002067 transcript:ENSEEUT00000002068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSAFELPADTVERIASKLRCHPTDERVALHLDQEDKLKHFRDYFYIPKVQDLPPIDLS
LVNKDDDAIYFLGNSLGLQPKLVKTYLEEELDKWAKMGAYGHEVGKRPWITGDETILGLM
TDIVGANEKEIVLMNALTINLHLLLXXXXXXXXXXXXXXXXXXXXXXXXYAIESQLQLHG
LDVEKSMLLIKPREGEEPLRTEDILEVIEKEGDSIAVILFSGLQFYTGQLFNIPAITKAG
QAKGCFVGFDLAHAVGNVELHLHDWGVDFACWCSYKYLNSGAGGLAGAFVHEKNAQTIKP
ALVGWFHELSTRFKMDNKLQLIPGANGFRISNPPILLVCSLHASLEIFRQATMKALRRKS
ILLTGYLEYLLKHYYSKDNARTKKTFVNIITPSHIEDRGCQLTLTFSVPIKYLFHELEKR
GVVCDKREPDGIRVAPVPLYNSFHDVFKFIHLLTSALQSAERKSA
Download sequence
Identical sequences ENSEEUP00000001886 ENSEEUP00000001886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]