SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002264 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002264
Domain Number 1 Region: 82-230,268-505
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.78e-81
Family GABA-aminotransferase-like 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002264   Gene: ENSEEUG00000002471   Transcript: ENSEEUT00000002478
Sequence length 514
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2395:2771:139592:-1 gene:ENSEEUG00000002471 transcript:ENSEEUT00000002478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILAWRYLWRALNLEKPSPRILKTCLSWNLAASWTTVTKLSLHTKPKMPPCDFTPERYQX
XXXXXXXXXXXXXXXXXXXXXXXXPLLLHQGHMEWLFDYEGNRYLDFFSGIVTVSVGHCH
PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIFLTNSGSEANDLAMLM
ARAHSNNTDIISFRGAYHGCSPYTLGLTNVGPFKMELPGGSGCQAXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXCCQAKDQYIEQFKDTLNTTVAKSIAGFFVEPIQGVNGAVQYPK
GFLKEVFKLVRDRGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAKGIGNGFPMAA
VVTTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIKEEKLQENSQEVGTYMLLKFAK
LRDEFEIIGDVRGKGLMMGIEMVSDKTSRQPLPREEVNQIHEDCKQMGLLIGRGGIFSQT
FRIAPSMCITKSEVDFAVEVFRSAIIQHMKRRDK
Download sequence
Identical sequences ENSEEUP00000002264 ENSEEUP00000002264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]