SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004105 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004105
Domain Number 1 Region: 261-344
Classification Level Classification E-value
Superfamily E set domains 5.88e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000004105
Domain Number - Region: 351-401
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00204
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004105   Gene: ENSEEUG00000004482   Transcript: ENSEEUT00000004512
Sequence length 590
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6211:4681:277249:-1 gene:ENSEEUG00000004482 transcript:ENSEEUT00000004512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPS
NLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDP
VIIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTVNVDGHVLAVSDNMFVHNNSKH
GRRARRLDPSEGTPYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVW
SELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQK
VIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHSQL
PALTNTSVHAGMMGVNSFSGQLAVNVSEASQATNQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISGMIVPPM
Download sequence
Identical sequences ENSEEUP00000004105 ENSEEUP00000004105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]