SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005793 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005793
Domain Number 1 Region: 275-362
Classification Level Classification E-value
Superfamily E set domains 4.62e-31
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000784
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005793   Gene: ENSEEUG00000006365   Transcript: ENSEEUT00000006346
Sequence length 429
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8850:1931:3941:1 gene:ENSEEUG00000006365 transcript:ENSEEUT00000006346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTAGRANPYSIVSSEEDGLHLVTMSGANSFRNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFTCVDIRWRYMLLIFSLAFLASWLLXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEASPLFGISRQDLETDDFEIVVILEG
MVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAKD
LVENKFLLPSASSFCYENELAFLSRDEEDEADAEQDSCSPQARHDFDRPQAGGSSSTLEQ
RPYRRESEI
Download sequence
Identical sequences ENSEEUP00000005793 ENSEEUP00000005793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]