SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006729 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006729
Domain Number 1 Region: 120-180
Classification Level Classification E-value
Superfamily E set domains 0.00000019
Family Filamin repeat (rod domain) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006729   Gene: ENSEEUG00000007369   Transcript: ENSEEUT00000007376
Sequence length 440
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4142:3201:17736:-1 gene:ENSEEUG00000007369 transcript:ENSEEUT00000007376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMNATSCKLLLVVLFIVGSWIFVTDFQNSRKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LVARDHRGHPKTHGGDLFRAQLLGPDLKAGVPGEVQDLENGTYLLSFPLLWAGRARVLVR
LIHSSEAVGVLKRIWTQVGATVDFRGYFRGPSRGDCGLQCGPAVNRGTGVCQYKDRSRGS
SGFAPSPQHPCLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRFGETGHFQCQPAVDL
EKNIHIQQQKHSRPLIISLTHSVKEIEHRPRVIDRIRMGGGKDTVLAVTSLGQRFGSFPT
DMFIKRALSVQKNKKRLLPR
Download sequence
Identical sequences ENSEEUP00000006729 ENSEEUP00000006729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]