SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008381 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008381
Domain Number 1 Region: 361-530
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.99e-27
Family GABA-aminotransferase-like 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000008381
Domain Number - Region: 121-189
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0126
Family GABA-aminotransferase-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008381   Gene: ENSEEUG00000009170   Transcript: ENSEEUT00000009196
Sequence length 544
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8744:11809:33156:1 gene:ENSEEUG00000009170 transcript:ENSEEUT00000009196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSSDTLHTDPSLKSQGAHTEVLERMGHLTQSIEEHIGQLSTGHQQLEAHSPGQGPGEQ
EALLSHQMGQVVSLLQSETNGLLPIPDSRVDIGAGQPGPFTQSDCETTLVSHDLSNRGND
ISTFYHTHFRNYILYHEDKYHEDKNPSGFINLATCQNKLCTDLITERLSREDMNIIEDTL
LQYPDWRGHPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFL
TPAPFYGTFVFSTSLYAKVELIHVYLDSEITEGNTRPFQLTVDKLEHTLLEAQLKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
PDPKRTHVIWGTSKCFGICGFRFGALYTHNKEVASAVSSFGYFHSISGIAQHKLCRLLQD
REWIDQVYLPISHSRLQVAHRYITDKLKELQIPYLHRGAGLYVWINLKKYLDPCTFEQEL
LLLRRFLDKKVIVGTGKFFLCKEPGWFRLVFAERYPQLKLAMDRFCQVLAEQQLEKQPED
TMRM
Download sequence
Identical sequences ENSEEUP00000008381 ENSEEUP00000008381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]