SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008629 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008629
Domain Number 1 Region: 81-480
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.24e-79
Family GABA-aminotransferase-like 0.0000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008629   Gene: ENSEEUG00000009451   Transcript: ENSEEUT00000009465
Sequence length 502
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8744:49971:61877:1 gene:ENSEEUG00000009451 transcript:ENSEEUT00000009465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLPQKNPRPLTSCPGPACTQNMDSNGGAGLRRECCCEPDQKQSKLYGVGDPAAMFSCD
SPYLSSRGNIIKWFWDSAEEGYRTYHMDEYDEKKNPSGIINLGTSENKLCFDLLSWRLSQ
SDMLQVEPALLQYPNWRGHLFLREEVARFLSFYCKSPAPLKADNVVVLNGCASLFSALAT
VLCEVGEAFLIPAPYYGAVTQHVHLYGSVQLVCVYLDSEVSGLATHPFQLTVGKLEEALQ
GAASQGVKVKGLILINPQNPLGYVYSPEELREFLEFAKRHALHVLVDEVYMLSVFVDTAG
YHSVLSLDRLPDPQRTHMMWAASKDFGMSGLRFGTLYTENQDVATAVASLCRYHGLSGLV
QHQMAQLLRDRDWINQVYLPENHARLKAAHTYVSEELAALGVPFLRGGAGFFIWVDLRKY
LPKGTSEEEMLLWRRFLDNKVLLSPGKTFECKEPGWFRLVFSDQPLRLSLGMQRVRQVLE
DQSPVAKNPPSCQPQDPSGQDK
Download sequence
Identical sequences A0A1S3WLU4
ENSEEUP00000008629 XP_016047346.1.11023 ENSEEUP00000008629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]