SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009634 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009634
Domain Number 1 Region: 109-422
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.12e-56
Family GABA-aminotransferase-like 0.000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009634   Gene: ENSEEUG00000010566   Transcript: ENSEEUT00000010571
Sequence length 521
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7077:6972:170749:1 gene:ENSEEUG00000010566 transcript:ENSEEUT00000010571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANPRGSDVCNGSLHNHKEQRDNLKTENCTKNGIVQEIQQNEESQCHYKPLVESFEEAPL
HVMVFTYMGYGVGTLFGYFRDFLRISGIEKCNAAVEREEQKNFVPLYQNFENFYTRNLYM
RIRDNWNRPICSAPGAQFDVLERVSDDYNWTFRFTGRVIKDVINMGSYNFLGLASEYDES
MRTVKEVLEEYGTGVASTRQEMGTLDKHKELEDLVAKFLNVEAAMVFGMGFATNSMNIPA
LVGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQNLEKLLRDAIVYGQPRIRRAWR
KILILVEGIYSMEGSIVNLPQIVALKKKYKAYLYMDEAHSIGAVGPTGRGVVEFFGMDPR
DVDVLMGTFTKSFGSSGGYIAGRKDLVDYLRVHSHSAVYATSMSPPVAEQIIRSMKFIMG
LDGTTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIVMKI
Download sequence
Identical sequences ENSEEUP00000009634 ENSEEUP00000009634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]