SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011727 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011727
Domain Number 1 Region: 295-474
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.91e-35
Family GABA-aminotransferase-like 0.0000000218
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000011727
Domain Number - Region: 16-80
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000128
Family GABA-aminotransferase-like 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011727   Gene: ENSEEUG00000012860   Transcript: ENSEEUT00000012875
Sequence length 476
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7744:12191:27365:1 gene:ENSEEUG00000012860 transcript:ENSEEUT00000012875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRHISQAAAKVDVDFDYDGPLMKTEVPGPRSRELMKQLNLIQNAEAVHFFCNYEESRGNY
LVDVDGNRMLDLYSQISSVPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPG
CPDYSILSFMGAFHGRTMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHGCAFL
VDEVQTGGGCTGKFWAHEHWGLEDPADVMTFSKKMMTGGFFHKEELRPNAPYRIFNTWLG
DPAKNLLLAEVISVIKREALLSNAVHAGKALLTGLLELQARYPQLISRVRGRGTFCSFDT
PDESVRNKLILMARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDILADFK
Download sequence
Identical sequences ENSEEUP00000011727 ENSEEUP00000011727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]