SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012052 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012052
Domain Number 1 Region: 213-544
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.16e-97
Family GABA-aminotransferase-like 0.0000000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012052   Gene: ENSEEUG00000013229   Transcript: ENSEEUT00000013225
Sequence length 587
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6782:13388:39956:-1 gene:ENSEEUG00000013229 transcript:ENSEEUT00000013225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTAAMLLRCCPVLAQGPTGIMGKIIKSHQFLFSNGRCPVLATQGPTYFQIHLKATKSGK
DSPVWAKSHCPFMLSELQDGKSLIVQKAAPEVQEDVKTFKTXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTLQRHGAGAGGTRNISGTSKFHVELE
QELADLHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHASMIQGIRNSGAVKF
VFRHNDSEHLKKLLMNSNPETPKIVAFETVHSMDGAICPLEELCDVAHQYGALTFVDEVH
AVGLYGSQGAGIGERDGIMHKIDIISGTLGKAFGCVGGYIASTRDLVDTVRSYAAGFIFT
TSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRV
GDAALNSKICDLLLSKHGIYVQAINYPTVPRGEELLRLAPSPHHNPQMMEDFVEKLLATW
SEVGLPLQDVSVAACNFCHRPVHFELMSEWERSYFGNMGPQYVTIYA
Download sequence
Identical sequences ENSEEUP00000012052 ENSEEUP00000012052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]