SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013098 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013098
Domain Number 1 Region: 108-527
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.81e-100
Family GABA-aminotransferase-like 0.00000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013098   Gene: ENSEEUG00000014342   Transcript: ENSEEUT00000014354
Sequence length 556
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1398:9946:57933:-1 gene:ENSEEUG00000014342 transcript:ENSEEUT00000014354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAPGGCCCRRPPRPNGCVANGEVRNGYVKSSAAAGQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFVSLYQDFENFYTRNL
YMRIRDNWNRPICSVPGARVDIMERQSQDYNWSFKYTGNVIKGVINMGSYNYLGFARNTG
ACQEAAAKVLEDYGVGVCSTRQEIGNLDKHEELEKLVARFLGVEAAMAYGMGFATNSMNI
PALVGKGCLILSDELNHASLVLGARLSGATIRVFKHNNMQSLEKLLKDAIVYGQPRTRRP
WKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPTGRGVVDYFGLD
PEDVDVMMGTFTKSFGASGGYIGGRKELVRYLRTHSHSAVYAASLSPPVAEQIVTSMKCI
MGQDGTTLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREM
LKRNVGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVP
LLDRPFDETTYEETED
Download sequence
Identical sequences ENSEEUP00000013098 ENSEEUP00000013098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]