SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014179 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014179
Domain Number 1 Region: 40-471
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.19e-162
Family GABA-aminotransferase-like 0.000000000000851
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014179   Gene: ENSEEUG00000015527   Transcript: ENSEEUT00000015535
Sequence length 483
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7680:9290:21915:1 gene:ENSEEUG00000015527 transcript:ENSEEUT00000015535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPFSFLRAARPLQRWGQLVSMATRCQHSEAAQTQTGEASRGWTGQESLSDSDPEMWELL
RREKDRQCRGLELIASEXXXXXXXXXXLGSCLNNKYLEGYPGKRYYGGAEVVDEIELLCQ
RRALEAFDLDPAQWGVNVQPYSGSPANLAAYTALLQPHDRIMGLDLPDGGHLTHGYMSDV
KRVSATSIFFESMPYKLNPQTGLIDYDQLALTARLFRPKIIIAGTSAYARLIDYACMREV
CDEVKAHLLADMAHISGVVAAKVIPFPKHADVGTTTTPQTLRGARSGLIFYRKGVRTVDP
KTGREIPYNFEDRINFSVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAM
ADALLKRGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITP
GGLRLGAPALTSRQFREDDFRQVVDFIDEGVCIGLEVKNKTAKLQDFKSFLLNDPETRHQ
LTD
Download sequence
Identical sequences ENSEEUP00000014179 ENSEEUP00000014179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]