SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016113 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016113
Domain Number 1 Region: 4-150
Classification Level Classification E-value
Superfamily E set domains 1.68e-56
Family RhoGDI-like 0.0000000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016113   Gene: ENSECAG00000018613   Transcript: ENSECAT00000019673
Sequence length 150
Comment pep:known chromosome:EquCab2:6:18981393:19026482:-1 gene:ENSECAG00000018613 transcript:ENSECAT00000019673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSIPGVEHEARVPKKILKCKAVS
RELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
SVLTGNVIIETKFFDDDLLVSTSRVRLFYV
Download sequence
Identical sequences F7AAZ5
XP_003365184.2.31192 XP_004674257.1.23501 XP_014718000.1.49734 9796.ENSECAP00000016113 ENSECAP00000016113 ENSECAP00000016113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]