SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005750 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005750
Domain Number 1 Region: 527-558,633-707
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000161
Family Anti-sigma factor antagonist SpoIIaa 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005750   Gene: ENSECAG00000006986   Transcript: ENSECAT00000007787
Sequence length 739
Comment pep:known chromosome:EquCab2:4:4060877:4091067:-1 gene:ENSECAG00000006986 transcript:ENSECAT00000007787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEILAATQRYSVDRPIFSHPVLQERLHKKDKVPDSIGDKLKQAFICTPKKIRNI
IYMFLPITKWLPYKFKEYVLGDVSGISTRVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIM
YCFLGTSRHISIGPFAVISLMIGAVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMSV
TLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFS
VVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMGTG
ISAGFNLQESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLA
NKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMIL
LVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFL
GLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAFEEVKEIPGIKIFQINA
PIYYANSDLYSSALKRKTGVNPAHIMGARRKAMRKYAKEVGNANMANATVVKVDAAVDGE
DGTKPEEEEDEIKFPPVVTKSTFPEELQRFMPPGDNIHTIILDFTQVNFIDSVGVKTLAG
IVKEYGDVGIYVYLAGCSAQVVNDLTQNRFFENPALKKLLFHSIHDAVLGSQVREALAEQ
EASAPPPQEDSEPNATPEA
Download sequence
Identical sequences F7DHC2
9796.ENSECAP00000005750 ENSECAP00000005750 ENSECAP00000005750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]