SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013803 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013803
Domain Number 1 Region: 522-554,657-732
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000832
Family Anti-sigma factor antagonist SpoIIaa 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013803   Gene: ENSECAG00000015837   Transcript: ENSECAT00000017041
Sequence length 790
Comment pep:known chromosome:EquCab2:5:2259479:2285257:-1 gene:ENSECAG00000015837 transcript:ENSECAT00000017041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLLNTFRCSPAKVKAAVFGLLPVLS
WLPKYKIKDYLVPDLLGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGI
HQMVPGTFAVISILVGNVCLQLAPESKFRVFDNATNESYVDTAAMEAERLHVSATLACLT
AIIQMGLGFVQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTVPSYTGPGSIVFT
FIDICKGLPDTNIASLIFALISGAFLMLVKELNARYMHKIRFPIPTEMIVVVVATAISGS
YKMPKKYHMQIVGEIQHGFPTPVSPVVSQWKDMIGTAFSLAIVGYVINLAMGRTLASKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLYALPKSVLGALIAVNLKNSLKQLADPYYLWRRSKLDCCIWVVSFLSSFFLSLPY
GVAVGVAFSVLVLVFQTQFRNGYALAQVLDSDIYVNPKTYNRVQEIKGVRIVTYCSPLYF
ANSEIFRQKVIAKTGVDPQKVLLAKQKYLKRQEKRRMPTQQRKSLFMKTKTVSLQELQQD
FENASPTDPNNNQTPADGASVSYITFSPDSSPAAHCEPPAAAEIPIEPSDMLASVPPFVT
FHTLILDMSGVSFVDLMGIKALAKLSSTYGKIGVQVFLANIHAQVYNDISHGGVFEDGCL
QRNHVFPSIHDAVLFAQANAREVAPGRDFQGSEGDEESSSFVIAQIMSSYYQLREEMFGS
MFHSETLTAL
Download sequence
Identical sequences F6TXG3
ENSECAP00000013803 ENSECAP00000013803 9796.ENSECAP00000013803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]