SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016977 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016977
Domain Number 1 Region: 550-665
Classification Level Classification E-value
Superfamily SEA domain 2.35e-18
Family SEA domain 0.0055
Further Details:      
 
Domain Number 2 Region: 215-315
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000222
Family SEA domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016977   Gene: ENSECAG00000019440   Transcript: ENSECAT00000020675
Sequence length 721
Comment pep:known chromosome:EquCab2:10:30581906:30663916:-1 gene:ENSECAG00000019440 transcript:ENSECAT00000020675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSTKIYYSETKDIDNAPRVETTESTAKMYKVSSMRQIFDLAKHRTKRSAFFPAGVKVCP
QESMKQILASLQAYYRLRVCQEAVWEAYRIFLDRIPDTGEYQDWVSICQQETFCLFDIGK
NFSNSQEHLDLLQQRIKQRNFPERKGEISPEETVGKPGDTLPFSTDVASISLGPLPLSPD
ETLLNVTQMPIQIGIRLWRALKQRETEFTELPRGPLEQKVELSISLANRRFKAELTDPQS
PYFQELAAESQLQMQKVFKKLPGFKEIHVLGFRPKKERDGSSSTEMQLTAIFKRDNAEAK
SSASDLLSFDSNKIENEGVPHGTMEEDQQTELYITALDLKKLISRALEEDQSLDVGTVQF
TDEIVGPLPGPDPDAQSGLPLLLADITKDATWSPELPLGQPRLEAADSTAHGLPDGSGSS
PTMASTSLSETLPFFTASSIFSLTDQSTIDIMSIDQTVQSPGLPIPTGDYSAVNQSALEI
LYSPAPSEDSRASTRSQDIVRDFDGMELSSMPAASEVPGLSGYVSSPDHFLENTTPVPTS
QYITTSSMTVAAKGQELVVFFSLRVANMPFSNDLFNKSSLEYQALEQRFTQLLVPYLRSN
LTGFKQLEILNFRNGSVIVNSRVRFARSVPYNLTEAVHGVLEGFRSAAAQQLDLEIDSHS
LDIAPADQADPCKFLACGESAQCVRNERTEEAECRCRRGCEGQGSLDGGDVGLCTPGEEC
E
Download sequence
Identical sequences F6VN89
ENSECAP00000016977 ENSECAP00000016977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]