SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017068 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017068
Domain Number 1 Region: 554-679
Classification Level Classification E-value
Superfamily PH domain-like 2.9e-19
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 2 Region: 89-270
Classification Level Classification E-value
Superfamily ARM repeat 0.000000188
Family HspBP1 domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017068   Gene: ENSECAG00000019233   Transcript: ENSECAT00000020773
Sequence length 733
Comment pep:known chromosome:EquCab2:4:66284266:66714560:-1 gene:ENSECAG00000019233 transcript:ENSECAT00000020773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFSGFTMPPPADTVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHECFALQHA
DSSNFYITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDV
TFAQEFINLDGICLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWD
TFSVAFIKKIASFVNKSAMDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQG
TDQEIQTYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVIRAQRAINNEMAHQL
YVLQVLTFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKSMYTR
DYKKLGFINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFG
RSSIELTKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATS
EDFNKVMQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPIL
ELKEKIQPEILELIKQQRLNRLVEGTCFRKLNCRRRQDKFWYCRLSPNHKVLHYGDLEES
PQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNF
IAPDKHEYCIWTDGLNALLGKDMMSELTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIP
KEPSNYDFVYDCN
Download sequence
Identical sequences F7DYL0
ENSECAP00000017068 ENSECAP00000017068 9796.ENSECAP00000017068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]