SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018463 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018463
Domain Number 1 Region: 353-467
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000785
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 650-704
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000262
Family cAMP-binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018463   Gene: ENSECAG00000020986   Transcript: ENSECAT00000022349
Sequence length 816
Comment pep:known chromosome:EquCab2:19:45416522:45477615:1 gene:ENSECAG00000020986 transcript:ENSECAT00000022349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELVGMSGIFTLAIMGLFLNSTSFKPGVEALLLEFWNCLSFAAFLMVFTFIGLLIPAHTYL
YISFSDIYYSLNIYLTLIVLRLLVFLFMSPLLSRLGDGFSWRWAFIMAWSEMKGMPNINM
ALLFAYSDHFLGSEREKSQILLHSKGVKVKYFFPNVFISICLLVKPRLRDVTSTKYKSLY
CTFQHFQEVTRSAASALKFDKDLADADWNMVEKAIVLQNPYALSQGETTEHQKVKCPDCN
KEIDETLNIEAMELANRRLLSAQIASYQRQYRNETLSQNAVQVLVGVAGSFGEKKGEHVS
PETIKNYSESKKILSFIRKVLLNWVYNTKKEKGVPSRHFFLRICHKIVFTDEFEYVGYLV
ILMNLFPIIISWIPGLNTIYEQELRHSNYSFLAFYILEALLKIAAMRKKYVSHTWNLFEL
AITIVGIIDVILIETNSIDYTFDLIQTMVFIKIVRLFRILRILKLVTPKLLQIIDKKMSH
QLSFRYAILKGYVQGEADIMTIIDQIASSKQVKKMLLSRLTRNTGHAMKELGYLEYDHPE
IVVTMKTKEEILVMLSLAREIVRVFRLKGIIHKIEGSEINKLIMAKKQEILDFQPIIKPL
TVEEALYHIPWLDKDEDHINFIQLQRSKPGLGIDQVLWETEEKDYPITYTDFLISGEIIG
ELNCLTNEPMKYSATCKTVVETCFIPKSDLYEAFEQYYPHIEYKMWLKLGLSITAQKIRG
HLSYEDWNYKMQLKLCNVCVKDIPQNIKTDMYDETVIYVILIHGALEDCQLRKAYKAPSL
IPLTCHQVQGTEDFTKVMIVQTPVDLKKFRWNTRKY
Download sequence
Identical sequences F6TQD8
ENSECAP00000018463 9796.ENSECAP00000018463 ENSECAP00000018463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]