SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|192293560|ref|YP_001994165.1| from Rhodopseudomonas palustris TIE-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|192293560|ref|YP_001994165.1|
Domain Number 1 Region: 543-761
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.42e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00083
Further Details:      
 
Domain Number 2 Region: 1133-1475
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.44e-43
Family PFOR PP module 0.00035
Further Details:      
 
Domain Number 3 Region: 11-226
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.59e-42
Family PFOR Pyr module 0.00028
Further Details:      
 
Domain Number 4 Region: 355-489
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.85e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0053
Further Details:      
 
Domain Number 5 Region: 835-871,947-995
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000837
Family Ferredoxin domains from multidomain proteins 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|192293560|ref|YP_001994165.1|
Sequence length 1662
Comment pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Rhodopseudomonas palustris TIE-1]
Sequence
MNAKYPGIPSVIHGNGAVAQVMGHVCGGVIGYPITPSTEISEIYEAFRSSGGCNVWGKHP
FFFEPEGEHSAQSGALGAALTGGKFISNASSSQGILYGLESHYVTVGKKVGGFVLQVAAR
VVSKHSLNVMAGHDDVYALLSSGYTILFGSNPQEAADLAAISYKVAAMSLIPVANAMDGF
ATSHMLSEALMPEPDLLREFLGDPAGRIPCPTVAQEMLFGAKGRVFQLKQYLLRHEADFM
PTELAALKKFLDDNADTIETDNAGTIVAETQRWVPEELRGQWKRQWINAPEKGTRQLVPA
LVDIDNPGLTGGVQNQPDFQAGAVDHRTHFANAVPHFVKEAMAEYASLTGREYKPVMTYM
CDDADHVVVGLGSVTDDAEAVAAYLRSQGKKVGVVSIKMLQPFPEAELVEALKGKTAVTV
LERSEVTALTQLVTQALCKARENGDAGVRHAGIPALTKLPKITTAIFGLGGHDLQPRDLI
ACYANMEKQDSAPFVYLGTKFFTENPSPRMEALQSRLKAAYPETQYMALETGTNPNLLPP
SAFRIRFHSIGGYGTIASGKLLTDILAGALDMHSKSAPKYGSEKSGAPTNYYITLSPEPV
KITNAELEDVEIVISPDHKVFVHTNPLRGLVAGGTFILQTNLSPLEVWRDMPAKARQTIR
DKKIKFYVIDAFAVAKRHAPTAELETRMMGIAFIGAVCGNVDRVVADASQDAMLNKIRQQ
ISKKFGAKGGDIVEGNMAVIREGLEATHKVDYDAAEFSEDAIKAAPKAKRDASISASMCR
VAAPASAAGFLDPEYYDDVLAAPFRDGTIAEAPVLPGIGMFMPAGSAAAKDKGLFRRNVP
EFKADLCTGCMECALVCPDAAIPNAVHDIHELLLTAIKQLDIAPAQQDALREKVPALTEA
IRDVYRGGKDDKPFNEIVAQAAEALNVDNATLNRNFGKLSGALSVYPVARTRPFFDAMEK
SQPGTGGLYSVSVDPWKCSGCLECIDVCGPGALVDREQDEPMLEQLQARFEFLSRTPNTP
ARFTESATKPEGETKRLMLDRANYYATTGGHGACRGCGEVTAIRLVTSTNHAIHDKRRKD
HIRELETLIDQLNAKRALVAGDDARAARIDQTLKTLEKRLYLYESGPTGNGPSGMVIANA
TGCSSVYASTFPFNPYTDPWVNSLFQDTPAVAKGIFEGLTAKASEDFRALRIAKLELADA
YDAAKHDGYFRYFGWSEFTPEERSMLPTVLSMGGDGATYDIGFGALSRLLATKTPIKVVV
LNTGAYSNTGGQTSTASLTGQDSDLSRFGIAQHGKQESRKELGLIASFHPNVFVVQTATA
LQGHFLKNVMEFLNHTSSPAVLDVYTPCQAEHGIGDAVANRQARLAVESRMNPVFVHDPR
KGSKLNNWFSLDGNPEADQDWATKTIEYVDADGKPQLLKAKLTPADFAHTEVRFRKQFKP
LKKDEGALPIDEYVALDPAARAGKTPFIYATDADKKLVKLSVGETVVALVEERRKYWRTL
QYLGGFDVRALDEAHSAELAALQHQYDEQVKARESSLDQIARGMSELAASSNAPAAGGFG
ALMNGFAAAPAAAAPTNGAKTANGNGAEPIHIDDADLGKCTNCKSCYQDVPEVFELTKIV
VDGAPKDVAHVIPGVFGKLKVTPELSAKLSRAAANCDAEIIR
Download sequence
Identical sequences B3QC89
395960.Rpal_5202 WP_012497840.1.13849 gi|192293560|ref|YP_001994165.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]