SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|195952898|ref|YP_002121188.1| from Hydrogenobaculum sp. Y04AAS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|195952898|ref|YP_002121188.1|
Domain Number 1 Region: 5-158
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.2e-24
Family MJ1460-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|195952898|ref|YP_002121188.1|
Sequence length 162
Comment 4-vinyl reductase 4VR [Hydrogenobaculum sp. Y04AAS1]
Sequence
MEFRDNLRILAEAIERESVLIHRSALIDGYKELFKLNKLGIGAFVKKAAELGGKKGAITL
KERYEVTTDKLSEALDLLTIIAESSRLITFMETSVENMEIYVEGSILVEAIPESKKPVCE
PMAGFFSGFLTELLQTKYNVVEVSCQAQGHEKCTFKIKKEAK
Download sequence
Identical sequences B4U7U9
WP_012513566.1.45798 380749.HY04AAS1_0523 gi|195952898|ref|YP_002121188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]