SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|195953643|ref|YP_002121933.1| from Hydrogenobaculum sp. Y04AAS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|195953643|ref|YP_002121933.1|
Domain Number 1 Region: 8-315
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.29e-102
Family UbiD middle domain-like 0.000000739
Further Details:      
 
Domain Number 2 Region: 316-477
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 5.89e-55
Family UbiD C-terminal domain-like 0.0000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|195953643|ref|YP_002121933.1|
Sequence length 482
Comment UbiD family decarboxylase [Hydrogenobaculum sp. Y04AAS1]
Sequence
MRSIKTTEELVNILEKEGELIKVKDPIDIHYEITEITDRMCKTKDPKALLFTNVKGYNVP
VLTNAFGSYKRLKIIFGYENLEDIGWKLYKVLRPEIPNTFLEKLKKLPELKKLNDALPKV
ESKNPYKTFSESVFDIPVLKCWPKDGGRYITLPQVITKDPESGIRNVGMYRIQLLEEKKV
ALHWQIHKDGNSHFHKAKRLGKKLPVAIAIGADPVCTYSASAPLPPEVDEYLFVGMVREN
PAELVKGKTVDIEYPKYADFVIEGYVDPEEPLIDEGPFGDHTGFYTPVDKYPAMHITAIL
SKDNPIYISTIVGPPPQEDKYLGYATERIFLPLIKFNLPEVVDYHLPASGVFHNFCFVSI
KKRYPGHAFKVAYALLGLGLMSLEKYIVVFDEWVNVHDIDEVLWIWGNNTDPLRDIIITK
GPIDVLDHSTNEVGFGGKIIIDATKKLKEEGYTRIWPEVAKTDDETKRKVDSIWQNISRF
LS
Download sequence
Identical sequences B4U9Z4
380749.HY04AAS1_1270 WP_012514311.1.45798 gi|195953643|ref|YP_002121933.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]