SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379718562|ref|YP_005310693.1| from Paenibacillus mucilaginosus 3016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379718562|ref|YP_005310693.1|
Domain Number 1 Region: 629-789
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.36e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 2-191
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0012
Further Details:      
 
Domain Number 3 Region: 139-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.51e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0017
Further Details:      
 
Domain Number 4 Region: 518-637
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.01e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379718562|ref|YP_005310693.1|
Sequence length 831
Comment protein NasD [Paenibacillus mucilaginosus 3016]
Sequence
MKRKLVLVGNGMAGVWCVEHMLKLAPQRFEVTIFGSEPHPNYNRILLSSVLAGDSSMKDI
VLNDWDWYRDNGITLHAGHTVTKIDKAKRTVTSDKGVTVPYDELILATGSRAFILPVPGA
DKEGVIAFRDIKDCETMMESAKKYKKAVVIGGGLLGLEAARGLLNLNMEVSVVHIHDYVM
ERQLDQTASSMLRTELEAQGMKFLLQKHTEQILGRDRVTGVKFKDGSVVEADLVVMAVGI
RPNVAIAKDHGIEVNRGIVVNDFLETNVPNIYAVGECAEHRGVAYGLVAPLYEQGDVLAK
RLCGLEVSGYEGSVTSTKLKVSGVDVFSAGQYREAPGTRAIKVVDEFDGIYKKVLIRDGK
VVGAVMFGDTSDSTRIFKLIRTGEDVSGREKEVVLGEGFGGAGGKSAGSGVAAMADDEII
CGCNGVSKGAIVKAINEQGLTSVDAIKACTGASRSCGGCKPLVGEVLQCTLGADGVTAAK
EGICGCTTLGRDEVVEAIRSMHLTTSKEVMNVLGWENTEGCSKCRPALNYYLGMVWPVEH
EEERESRFVNERNHANIQKDGTYSVIPRIYGGVTSPQELKRIAEVAEKYEVPLVKFTGGQ
RLDLLGVKKEDLPKVWEDLDMPSGYGYGKALRTVKTCVGNTFCRFGTQDAMGMGIAIERR
FERLNTPAKVKIAVSGCPRNCAEATIKDFGIVAIDGGWELHVGGNGGVKVRATDLLCKVK
TEEEVMEYAAAYLQFYRETGKWNERTSEWLPRVGLETVRAALDTPEKRQALVARIDEALQ
VMTDPWKEIIETPSLRATFEELPGSLAVDASAAAEAAAGLESEAAAAVERP
Download sequence
Identical sequences H6NT03
gi|379718562|ref|YP_005310693.1| WP_014368391.1.63014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]