SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379719675|ref|YP_005311806.1| from Paenibacillus mucilaginosus 3016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379719675|ref|YP_005311806.1|
Domain Number 1 Region: 631-797
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.49e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00073
Further Details:      
 
Domain Number 2 Region: 5-194
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.73e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0011
Further Details:      
 
Domain Number 3 Region: 148-310
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.13e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0024
Further Details:      
 
Domain Number 4 Region: 521-626
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.8e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379719675|ref|YP_005311806.1|
Sequence length 813
Comment protein NasD2 [Paenibacillus mucilaginosus 3016]
Sequence
MNATTTRQRLVVIGNGMAGINTVEQILKLDPQRYEITVFGSEPYPNYNRIQLSYVLEKSK
SIDEIILNSWEWYRENGIDLRTGTTVTRIDTDSRTVHTEDGTVVPYDKVIVATGSKPLML
PIPGADKEGIVGFRDIADCETMLHAAKLYRKAAVIGGGLLGLEAAKGLLKLGMDVTVVHL
VEELMERQLDRTASLMLQAELESQGLKFATGRQTAEFLGGQRVTGLRFSDGTTLEAEFVV
MAAGIRPNTEVGRASGLTVNRGIVVDDYMRSSAPDVYAVGECGEHRGVCYGLVAPLFEQG
AVLAKHLCGVETKPYEGSVVSTQLKISGVDVFSAGEFMDAPDLNVVRMHDEWHRIYKKVL
LRGGRIVGGVLVGDGKQAARLQQWIRTGTVMTEEIHAAIMGTAAAEAGNSAADLPDEEIV
CGCNGVTKKHIVDAIRDNGLTTVDEIKACTGASRSCGGCRPVVEQILQFTLGDKYDSAAA
KKEGICGCTKLTRDEVVAGIQEKGLLTSKEVMHVLGWDNPEGCSKCRPALNYYLGMIWPA
EHQDEKDSRFVNERMHANIQKDGTFGVVPRMYGGVTTPEDLRLIADVAVKYNVKLVKVTG
GQRLDLLGVSKEDLPKIWEDLGMPSGYAYAKALRTVKTCVGSQFCRFGTKDSMGMGILLE
KKFERLDMPAKFKLAVNGCPRNCAESSTKDIGIVGNEGAWEIYVGGNGGIKSRLADLLCK
VKTDEELVEIVAAFMQHYRETGKYLERTSDWIERVGLASVTAAVVEDTENRKALAARMET
ALSQVKEPWKEVLDNPVLRQRLYSEIQVPVGTK
Download sequence
Identical sequences H6NEW6
WP_014369191.1.63014 gi|379719675|ref|YP_005311806.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]