SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379722004|ref|YP_005314135.1| from Paenibacillus mucilaginosus 3016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379722004|ref|YP_005314135.1|
Domain Number 1 Region: 298-509
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.15e-38
Family ABC transporter ATPase domain-like 0.0000913
Further Details:      
 
Domain Number 2 Region: 23-287
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.31e-21
Family DNA repair protein MutS, domain III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379722004|ref|YP_005314135.1|
Sequence length 673
Comment DNA mismatch repair protein MutS domain-containing protein [Paenibacillus mucilaginosus 3016]
Sequence
MDKNMQMKVDMAGCLEYEKVKEGLLDHAKSYLGREHIRALMPVTDQGLIERWLEESAEAV
KLIEHGASVPVPALDGMETMAAGLGKGFLLTVSELGVIVKFLENTAQLKRFMSRKESIAP
QVTSYALSLYELSEIRLEIERCIRHGAIDDGASPELAKVRKKIAIAEERLKKKLESTMQR
YRSYLQEQVISMRGDRYVIPVKKEHRKLVAGSVLDESASGQTVFIEPAETASLTYELSAL
RAEESREETKVLGLLTDLVESHTQEIRLNLETIGHYDFLFAKAKYGLSIGGRTVEIGSDG
RTRILRGRHPLLGAHAVPLDFEIGESYRALIITGPNTGGKTVTLKTVGLLTMMVQSGLMV
PAAEGSRFSIFHSVLADIGDGQSLEQSLSTFSSHVKNVIRILDEAGPSALILLDELAAGT
DPGEGIGLSIAVLEELYRRGSTVIATTHFNEIKRYAEAAEGFENARMEFDVETLRPLYRL
TIGEAGRSYAFQIAAQLGMPAGIIARSKAITYGPAAAAGEAGGSSAASSSAGAGLVSLEE
ALQGPDREGAAGAGPSAGQRQQQPVRRGKREAARELQAEFEIGDCVWIHSQRRTGIVCGL
ADERGNLLILIQKEKVKINRKRLSLYIEREQLYPEGDYDMDIVFESKEVRKKRKMMSKRH
DESVMIIHPPQGE
Download sequence
Identical sequences H6NLQ2
WP_014370809.1.63014 gi|379722004|ref|YP_005314135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]