SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379722284|ref|YP_005314415.1| from Paenibacillus mucilaginosus 3016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379722284|ref|YP_005314415.1|
Domain Number 1 Region: 147-346
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.09e-55
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000106
Further Details:      
 
Domain Number 2 Region: 432-563
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.89e-37
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000479
Further Details:      
 
Domain Number 3 Region: 12-146
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.94e-34
Family Duplicated SiR/NiR-like domains 1 and 3 0.0033
Further Details:      
 
Domain Number 4 Region: 348-423
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.55e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379722284|ref|YP_005314415.1|
Sequence length 574
Comment protein CysI [Paenibacillus mucilaginosus 3016]
Sequence
MSENNLLSPNSAPHSDVEDIKRRSNYLRGSLEETLQDRITGSIPEDDNRLMKFHGSYMQD
DRDLRNERQKQKLEPAYQFMLRVRAAGGVVTPDQWLMMDRVAQKYANGTIRLTTRQSFQL
HGVLKWNMKSTIKEVNDAMLSTLAACGDVNRNVMANPNPYESEVHGEVYEWASRISNHLD
PRTRAYHEIWLDGEKVVDSRDNEEQEPIYGPVYLPRKFKIGMAIPPSNDVDVFSQDLGYI
AIVEDGRLKGFNISVGGGMGMTHGDPATYPQLAQVIGFCTPEQAVDVAEKTVMIQRDYGD
RSVRKHARFKYTIDDRGIEWFIGELTSRLGYSLEPAREFRFDSNGDRYGWVEGTNGKWHF
NLFIQNGRVMDEEGYPLMTGLREIAKVHTGDFRLTANQNLIISNVTTAKKKKIDALIKEY
ALTDGLHYTALKRNSMACVALPTCGLAMAESERYLPTLLDKLEPMLVENGLRDEDIVIRM
TGCPNGCARPMLAEISFIGKAPGKYNMYLGGGFAGQRLNKLYKENIGEAEILESLQGMFS
RYAKERNEGEHFGDFVIRAGYVKETRSGQDFHAV
Download sequence
Identical sequences F8F9D7 H6NB11 I0BMJ4
gi|379722284|ref|YP_005314415.1| gi|337749334|ref|YP_004643496.1| WP_013918779.1.16585 WP_013918779.1.53882 WP_013918779.1.63014 gi|386725030|ref|YP_006191356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]