SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379722972|ref|YP_005315103.1| from Paenibacillus mucilaginosus 3016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379722972|ref|YP_005315103.1|
Domain Number 1 Region: 7-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-83
Family Protein kinases, catalytic subunit 0.00000116
Further Details:      
 
Weak hits

Sequence:  gi|379722972|ref|YP_005315103.1|
Domain Number - Region: 364-394
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0719
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Further Details:      
 
Domain Number - Region: 502-566
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.085
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379722972|ref|YP_005315103.1|
Sequence length 734
Comment serine/threonine protein kinase with PASTA sensor [Paenibacillus mucilaginosus 3016]
Sequence
MIGRQLGGRYEILERVGGGGMAIVYKGLDILLHRHVAVKILRQQYVHDEEFIQRFRREAQ
AAASLSHPNVVSIYDVGQEDDVHYIVMEYIEGTTLNDRIKEKAPLQVEEAVHIAGQICDA
LDHAHHNQIIHRDIKPHNILIGKNGRVKVTDFGIARAVTSSTITQTGSVVGSVHYFSPEH
AKGTTTGEQSDLYSLGIVMYQMLTGRLPFLGESPISVALKHLQEDVEEPRKVNPLIPQSV
ENIILRAMRKSTAERYRSAKEMLGDLESCLQPHRRGEPKVSFFDDDDMDEERTRVMPAIR
PGQYEISAVEDDEPPKPAASENPPEKKKGGWVKPVMWLLVLAVMVGGMWYLVRYVQAVTT
APEDVMVPDLRGRPVAEARQTLESLGLGVDIEPQSSTEVPKETVILQDKANMKIRKDSRV
KLTVSTGPPPQKMPDLKKLKLADAKTKLLQLGIKAENIKTDDMVMDEEPGLVLTQTPAAN
AEFTDPAATQVTLGVSKGPETIPMPNLIGLSENEAKNKILVNKLKIAKDGVSYQPNYKLS
QGKVISQFPYQPDEVVAPGTEISLTVSSGLPKEAGQMAVNVPVRPAKEGAVSTVKIILTD
ASRESVEYQTLTGVDKLQTFQVNVVVSPEQNASIQIKADNTVIDVITVTYEDFKNHGKSG
KPFTPGTGTGAGTAEPGGAAGSTTAPSGTTGTGGNGTGTGGTGAAKPGTETPAAGTQEPA
GTSGNTTGTGGQNP
Download sequence
Identical sequences H6NQW1
gi|379722972|ref|YP_005315103.1| WP_014371466.1.53882 WP_014371466.1.63014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]