SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379723228|ref|YP_005315359.1| from Paenibacillus mucilaginosus 3016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379723228|ref|YP_005315359.1|
Domain Number 1 Region: 215-612
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.61e-94
Family beta-Lactamase/D-ala carboxypeptidase 0.0000259
Further Details:      
 
Domain Number 2 Region: 48-110,152-261
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.2e-27
Family Penicillin binding protein dimerisation domain 0.0027
Further Details:      
 
Domain Number 3 Region: 628-682
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000262
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.006
Further Details:      
 
Domain Number 4 Region: 687-729
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379723228|ref|YP_005315359.1|
Sequence length 812
Comment peptidoglycan glycosyltransferase [Paenibacillus mucilaginosus 3016]
Sequence
MEKQIKFRSLFIGGGFALLFAVLVVRIFWVQVVEGDVYLGKAQEYWVRESKIPAQRGSVL
DRSDKVLAEDGPAATLALRPGDIAENGLQEDIVRGLAQIIKTSDDPSSQLQLEEKIRSRI
TSGLEKIQSGQNDKNLQVEIRNEGWKIGAEQIDLINKFIAEQEAILKERFGKDKKAKVPP
VGIFLIPEESKRFYPGQQLAAHLLGYVNKEGKPVMGLEKQLDNVLKGTDGFLHLEKDRRG
VELLNGEKRYQPAVNGNNVRLTLDKNVQFYMESALEKVAAKWNPKSMTAIAVDPMTMEIL
GLANYPTFNPNRYGEFDIKNFTNHAVASQYEPGSTFKLVTLAGAVQEGKFLPEEKYQSGS
IRILDRRLHDHNISGWGRITYLEGLKRSSNVAFVKLGMEALGQEALKGYIEKFGFGAKTG
VDIPGEVPGIVNLRVPADFATATYGQGALTVNAMQLTAAYAAIANGGTLMKPYLIKEIYN
PLTGEVIDENKPEEIRRVVSPETAKQVTEYLETVVSDKKIGTGKNAAIDGYRIAGKTGTA
NKVLPGEKTYAEGKWVISFAGYAPADNPRILVTILVDEPDLGGDYHLGGEVAAPAFKQIV
SQTLRQWGIAPTTQVKSGDAAAQEPGTKVPNLVGRTPEEARAATDAFGVVLETLGSGPKV
LAQSPAPGTEIGGAQRMYVVLEEGTELEVPDLSGKSLRDAVEVCSFVKVRCQSIGEGYVA
SQVVEGSGETRTVTLTLKPYSELLETVETDSKDTKTPAKNEKSTKAAGGKTTETGSKEGA
KTSSASAGSTAKKTTTEKEAEESGSSASGLRE
Download sequence
Identical sequences H6NG83 I0BQ65
gi|379723228|ref|YP_005315359.1| gi|386725951|ref|YP_006192277.1| WP_014371636.1.53882 WP_014371636.1.63014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]