SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379724074|ref|YP_005316205.1| from Paenibacillus mucilaginosus 3016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379724074|ref|YP_005316205.1|
Domain Number 1 Region: 298-522
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.25e-47
Family ABC transporter ATPase domain-like 0.0000468
Further Details:      
 
Domain Number 2 Region: 27-293
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.97e-30
Family DNA repair protein MutS, domain III 0.013
Further Details:      
 
Domain Number 3 Region: 717-793
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000000523
Family Smr domain 0.0072
Further Details:      
 
Weak hits

Sequence:  gi|379724074|ref|YP_005316205.1|
Domain Number - Region: 549-607
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00453
Family BAR domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379724074|ref|YP_005316205.1|
Sequence length 794
Comment recombination and DNA strand exchange inhibitor protein [Paenibacillus mucilaginosus 3016]
Sequence
MNKNSSYSQKILATLDFHAVLERCAAHASTSLGKSRVEELEPSGSFDEVKRRLQATDEAV
NVERLKGGAPFGGIRDIRPALHRARIGGMLNPAELLDIALTSQGGRRLQRFLESINEDYP
VPLLVESTEPMTDHKALEDRIRQCIDENAHVVDSASPELARIRSELRGSESKARERLEQM
VRTPSIQKMLQDNLVTIRNDRYVIPVKQEYRSHFGGMIHDQSASGATLFIEPEAVVQMNN
RVRELKLKEEAEVEKILRMLSALVAEAADLLVVNVEILGELDFIFAKAGLARTMKATLPL
LNDRGFIKLKRGRHPLIASENVVPLDVELGGKYSSIIVTGPNTGGKTVSLKTIGLLSLMA
MSGMFVPAEEGSQLCVFDAIYADIGDEQSIEQNLSTFSSHMTNIIRILREMTPKSLVLLD
ELGAGTDPAEGSALAISILDYMHRMGCRIVATTHYTELKAYAYDRQGVINASMEFDVQTL
RPTYRLLVGVPGRSNAFAIAERLGLSRSIIENARGQVGEEEQRVESMIATLEQNTIQAEA
ERATAQELRREVETLREKLNAERHRFEEQRDKLLEKAEREGREAVAKARREAEEVIAELR
RLQREEAGGVKDHKLSELKKKLNDAAPELRSKQVSQLPKKKPETIGPGDEVLVTNLGQRG
HVVDVVNAQEYTVQLGILKMKVNKADLELVKQAPQKKAEPPKATSSLKRTRDENAKMELD
LRGANVEEAMIEVDRFLDESYLANFGQVYIIHGKGTGVLRAGIQEYLRKHKHVKSYRMGN
YNEGGAGVTVAELK
Download sequence
Identical sequences H6NGH4
gi|379724074|ref|YP_005316205.1| WP_014372173.1.63014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]