SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379724081|ref|YP_005316212.1| from Paenibacillus mucilaginosus 3016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379724081|ref|YP_005316212.1|
Domain Number 1 Region: 210-404
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.62e-72
Family B3/B4 domain of PheRS, PheT 0.00000364
Further Details:      
 
Domain Number 2 Region: 477-706
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.19e-49
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00015
Further Details:      
 
Domain Number 3 Region: 37-200
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.32e-44
Family Myf domain 0.0053
Further Details:      
 
Domain Number 4 Region: 713-811
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 9.02e-31
Family Anticodon-binding domain of PheRS 0.00037
Further Details:      
 
Domain Number 5 Region: 412-485
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.87e-19
Family Domains B1 and B5 of PheRS-beta, PheT 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379724081|ref|YP_005316212.1|
Sequence length 812
Comment phenylalanyl-tRNA synthetase subunit beta [Paenibacillus mucilaginosus 3016]
Sequence
MKVSYQWLSQYVDVSGFTAGELAEKLTRSGIEVDIVENRNKGVTEVYAGYVKSREKHPDA
DKLSVCIVDVGKGEDLQIVCGAKNVAAGQKVPVAVVGAKLPDGLAIKRAKLRGVESQGMI
CSAKELGLNDKLLPKEIQEGILVLPEDTEIGASILDVLAINDEVMDLDLTPNRSDALSML
GAAYEIGAILGREVKLPQAEQGGTGAVQAAERISVEITAKEQCTHYAAALIEGVKVGVSP
LWIQNRLMAAGIRPINNIVDVTNYVMLEYGQPLHAFDADKLENGHIDVRLAKAGEKLVTL
DEVERTLEPHMLLITDGVKPVAIAGVMGGANSEVTDGTVRILLESAKFDGGTVRKTSRQL
GLRSEASLRFEKEVNPEAVLPALHRAASLIAELSGGTVASGVVEARTAEHKPVAIELTVG
RINGYLGTSLTVEEVKEIFARLNFTVEPLEADGLLVHVPSRRGDITRAVDLIEEVARLHG
YDNIPTTLMHGVTTPGALTKEQSIRRLTRTLLTGSGLHEAITYSFTHPDQIAAYPGAYGE
AQPVKLAMPMSEDRSVLRTSLIPHLLDVAVYNRNRNQDDVAVFEMGRVFVSNEAELRSLP
QEKLLLAALLTGKRSELHWTGKPGVVDFYDLKGVLEGLLSYLGIDAKYVPAQPKGFHPGR
TAEIAVERDGIRKVVGVIGQLHPELQQQKDLSDTYVLEVELETLAELVDDSFTYKPLPRF
PAISRDTAVVVDRTVAVGDLVAKAQETAGGLLESIQVFDIYTGERLGENKKSVAISLVYR
TPERTLTDEEVSELHGRVVASLEEAFGAELRK
Download sequence
Identical sequences H6NGI1
WP_014372176.1.63014 gi|379724081|ref|YP_005316212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]