SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379724719|ref|YP_005316850.1| from Paenibacillus mucilaginosus 3016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379724719|ref|YP_005316850.1|
Domain Number 1 Region: 13-243
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.61e-62
Family PP-loop ATPase 0.00014
Further Details:      
 
Domain Number 2 Region: 380-461
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.4e-20
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0071
Further Details:      
 
Domain Number 3 Region: 224-329
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000000017
Family MesJ substrate recognition domain-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379724719|ref|YP_005316850.1|
Sequence length 473
Comment tRNA-lysidine synthetase [Paenibacillus mucilaginosus 3016]
Sequence
MRSGAGWPARVEKWIRKEALLAPGDGVVVAVSGGPDSVGLLHLLFGLSARYEWRLIVAHV
NHGFRAEESEREAELVARHAARLGLALHTVRLDMPSVLAAGGENPQAAARERRYAFLLDV
ARRTGARRIATAHHADDQAETVLMRILRGTGLSGLAGIPLRRTISDGVELIRPLLRIYKS
EIEAYCEAEGLEYCTDSSNLQAKYTRNQVRLELMPYLKQYNDKLPEALVRLAETAGSEDS
FLEEQTRLLYEANIGRRDGAYVWSARWFAGVHIALQRRLIKLILSYLAADRNSMDFLHIE
SVRLAILSEEPVNFRREVVQDIMLAREYDRIAVHTMVLPPRAYVHELGEGLQSFTIPETG
VRIELQRLEGEDPVAGEAATYTAIFDAEELFLPLIVRSRLPGDRMQPLGLNGTKKVKDMF
IDAKVPPSLRERIPLITDARGNIIWVPGVRTSAMGAVTASTRSRLRLRLVMPN
Download sequence
Identical sequences H6NSF1
WP_014372578.1.63014 gi|379724719|ref|YP_005316850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]