SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379722990|ref|YP_005315121.1| from Paenibacillus mucilaginosus 3016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379722990|ref|YP_005315121.1|
Domain Number 1 Region: 19-202
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.79e-56
Family Methylesterase CheB, C-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 289-483
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.41e-49
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00036
Further Details:      
 
Domain Number 3 Region: 1039-1195
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.36e-38
Family Histidine kinase 0.0032
Further Details:      
 
Domain Number 4 Region: 846-969
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.14e-23
Family Flavin-binding PAS domain 0.026
Further Details:      
 
Domain Number 5 Region: 226-291
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000119
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0065
Further Details:      
 
Domain Number 6 Region: 979-1046
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000012
Family Homodimeric domain of signal transducing histidine kinase 0.0038
Further Details:      
 
Domain Number 7 Region: 753-856
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000602
Family Flavin-binding PAS domain 0.033
Further Details:      
 
Weak hits

Sequence:  gi|379722990|ref|YP_005315121.1|
Domain Number - Region: 660-738
Classification Level Classification E-value
Superfamily Tropomyosin 0.000937
Family Tropomyosin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379722990|ref|YP_005315121.1|
Sequence length 1198
Comment signal transduction histidine kinase with CheB and CheR activity [Paenibacillus mucilaginosus 3016]
Sequence
MSTILSEQDVQEQSPPGGFIVGIGASAGGLEALQQFFDHMRPDCGLSFVVVQHLSPNYKS
FMAEILTKNTSMNIYEAEHLMEVRPNCVYLIPPKKDMTIAGRTLQVTEHRQTTGLNLPID
MFLTSLAKDIGSRAIGVILSGTGSDGTRGVEAIKEHGGLVIVQDELTAKFDGMPNSARLT
GIVDQVMTPQAMADYLIEWTTGDPEIEWEDGESDPGSSGRLDLLSLPSFLELLKNASGID
FSYYKENSILRRIERRMNLLGVTTSDAYLRLLGNQPDELASLSKDLLIGVTHFFRDPEAF
EILRVKVLPAIIENKKREGHIRIWVAGCSTGEEAYSLAMLFDELISGQELPYTVKIFATD
LDRDSIEYASQGVYPESAVRSVPSELLQQHFTQVGENYQVSKSIRKMVVFAPHNITKDPP
FSNLDLVTCRNMLIYLQSDVQQKVLSLFHFALNPNGFMFLGPSETVGKLSSLFYAFDRKW
NIFQQRSRMSGSPIPSAVEVSDSVDITKVHQLARRGYTTLREIPAYRKPDDLYTSFVDEH
MPPCMVLDENNEVLHLSGNINPYLALARGKPSWNIYKMVEAHLAVAIVTAVQKVRKEQRT
IYYQDIRLNNSDQSPYINLTVKPFSTKNKKFDRLVLVTFEDADLPPPAPQIPEAFDMDHN
VNQRIVELEQELQRAEESLQATIEELETSNEELQATNEELVAANEELMSTNEELQSVNEE
LVTVNTEYQYKIQELTDLNNDMDNFLVSTKIGTIFLDKEMRIRRFTPAITREINLLEVDY
GRPIRHISHNFLYEGIVQDAETVLRTLVPVEKEIQSRSGSWYMLRVLPYRTGDHFIKGIV
LTFVDITELKSANEELLKLSHAIEQSPSITLLANLEGIIMYANPKFAEVTGHAQSEMIGV
HFRELNDWQASSVSFTEVWSTLSSGREWRGELHSRRKDGETYWESVRFLPIKDGEGRTQH
YLRIAEDISDRKQTEELLRKSEMLSAVGQLAAGIAHEIRNPLTALKGFTKLMGTGGHNES
YLAIMSAELERIEEIVSELLVLAKPQAVDYLPKSVPSILQDVIMLLDTQAIISNVEIETE
IDEPLPYVSCVENQLKQVFINVLKNSVEAMPKGGTITVRAKRTEDRRLRVSFIDQGLGIP
ESKLARIGEPFFTTKNKGTGLGLMVSYKIIENHQGTMQISSKEGVGTTVEILLPALSS
Download sequence
Identical sequences H6NQX9 I0BPN9
gi|386725775|ref|YP_006192101.1| gi|379722990|ref|YP_005315121.1| WP_014371480.1.53882 WP_014371480.1.63014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]