SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379723019|ref|YP_005315150.1| from Paenibacillus mucilaginosus 3016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379723019|ref|YP_005315150.1|
Domain Number 1 Region: 47-320
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.79e-87
Family L-arabinose binding protein-like 0.0000000675
Further Details:      
 
Domain Number 2 Region: 2-45
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000015
Family GalR/LacI-like bacterial regulator 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379723019|ref|YP_005315150.1|
Sequence length 323
Comment protein CcpA [Paenibacillus mucilaginosus 3016]
Sequence
MATVSRVVNNNPNVKPQTRKKVFEAIERLGYRPNAVARGLASKKTTTVGVVIPDISNSIF
SEVARGIEDIANMYHYNIILCNADKKKEKEIRVINTLLEKQVDGLLFMGGAVTEDHIQAF
KTSSVPVVLCATADEQRVIPSVDIDHEKAAFDAVNVLLQSGHTKIAMISGTLQDPANGYA
RYQGYRKALEAANIPIDEDYVRIGNYRYESGMDVTKHFLELDERPTAIFAATDEMAIGAI
HSLQDSGLRVPEEMSVISVDNIRMASMVRPQLTTVAQPMYDIGAVAMRLLTKLMNKETKD
ASELTQVILPHEVIHRNSVAQRS
Download sequence
Identical sequences F8F904 H6NR08
gi|337748160|ref|YP_004642322.1| gi|379723019|ref|YP_005315150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]