SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194366846|ref|YP_002029456.1| from Stenotrophomonas maltophilia R551-3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|194366846|ref|YP_002029456.1|
Domain Number - Region: 87-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00131
Family NfeD domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194366846|ref|YP_002029456.1|
Sequence length 147
Comment hypothetical protein Smal_3074 [Stenotrophomonas maltophilia R551-3]
Sequence
MRWEVVGWGALALLLFAAEALAPGAFMLWIGIGAAAVFVLVAVFGDIPLLWQVVAFVLLS
VVSIQCYRRWGRPRARPSDAPLLNRRTEQLIGRVVALQQGIVDGHGRVSIDDASWQVTGP
ELPAGAWVKVLSVQGTVLVVEAAGRPL
Download sequence
Identical sequences A0A2J0UM55 B4SSE1 M5D1L6
WP_006385101.1.100705 WP_006385101.1.41422 WP_006385101.1.52398 gi|194366846|ref|YP_002029456.1| 391008.Smal_3074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]