SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194366999|ref|YP_002029609.1| from Stenotrophomonas maltophilia R551-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194366999|ref|YP_002029609.1|
Domain Number 1 Region: 225-269,302-546
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.62e-39
Family CoA transferase alpha subunit-like 0.014
Further Details:      
 
Weak hits

Sequence:  gi|194366999|ref|YP_002029609.1|
Domain Number - Region: 25-117,144-261
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 0.0289
Family CoA transferase alpha subunit-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|194366999|ref|YP_002029609.1|
Sequence length 650
Comment hypothetical protein Smal_3227 [Stenotrophomonas maltophilia R551-3]
Sequence
MTEHLTDLDAAVDWLFARVDGPLRIGAPLALGKPHRLLNALYARVEHDPSRPLQLYTALS
LNPPKARGNGLEARFMAPFAQRHFGDDFPRLAYADAIARDALPAHVQVEEFYMQSGALLG
SRQAQSSYTSLNYTHAADAVAQRAPQVIVQKVAMRPDDRRLSLSCNNDITQDTLDAIAAR
GLPRPLLVAEIDPQLPYLGGSATVDVSFFDLVITPPPPYPALFGLPRQPVGDADYAIGLY
ASTLVRDGGTLQIGIGTLADALSHALVLRHTDNARYRRVLHALDPQLASHPLVQEIGGLE
PFEVGLYGCSEMLNEGFRRLVQTGVIKRKVHDDLALMQRIENGSTLSIDHATLAAEGEYL
HGAFYLGSPEFYEWLRTLPEDECRAIGMRRISEINQLYGGNETLERLQRRHARFFNSCMM
ATALGAAVSDALDDGRVVSGVGGQYNFVAMAHALPEARSVLMFRAARDDKGQRESNVRWN
YGHTTIPRHLRDIYLNEYGIADLRGLTDEDCVHAMTAITEAPFQGGLLQQAHTSRKLLAA
KQPDPERQQRNTPQALTAALAAFRADGTLPDYPLGSDFNEIEQVLVKALGWLKANTQTRG
DKLRTVWAALRQPAGDGDAVYLQRMGLQAPKDFAERLDARLLRLALARTA
Download sequence
Identical sequences B4STW3
WP_012511968.1.100705 391008.Smal_3227 gi|194366999|ref|YP_002029609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]