SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332798697|ref|YP_004460196.1| from Tepidanaerobacter acetatoxydans Re1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332798697|ref|YP_004460196.1|
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily YheA/YmcA-like 1.12e-25
Family YheA-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332798697|ref|YP_004460196.1|
Sequence length 114
Comment hypothetical protein TepRe1_0702 [Tepidanaerobacter acetatoxydans Re1]
Sequence
MNVYDLAHQLARSLNESQEYLEYKKAKETIKQDPQVEKMLKDLRAKQIEVQALSISGKPI
AEAQKSLENLYNIAVNNSLLRQYLEAEERFAVLFTDIQNIIIKGIEFDIDTEDK
Download sequence
Identical sequences F4LWI7
WP_013777812.1.59919 WP_013777812.1.8343 gi|332798697|ref|YP_004460196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]