SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332799471|ref|YP_004460970.1| from Tepidanaerobacter acetatoxydans Re1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332799471|ref|YP_004460970.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily L21p-like 1.83e-40
Family Ribosomal protein L21p 0.0000862
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332799471|ref|YP_004460970.1|
Sequence length 103
Comment 50S ribosomal protein L21 [Tepidanaerobacter acetatoxydans Re1]
Sequence
MYAVIETGGKQYRVSEGDIIQVEKLPADVGESIEIDKVMALSEDNGLKVGKPWLENAKVT
AKVLRHGKSDKIIVFKYKPKKNYRKRQGHRQPFTEIQIEKIEG
Download sequence
Identical sequences F4LVZ5
WP_013778586.1.59919 WP_013778586.1.8343 gi|332799471|ref|YP_004460970.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]