SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334338676|ref|YP_004543656.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334338676|ref|YP_004543656.1|
Domain Number 1 Region: 144-388
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.88e-65
Family Extended AAA-ATPase domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 3-188
Classification Level Classification E-value
Superfamily CheY-like 6.83e-29
Family CheY-related 0.00031
Further Details:      
 
Domain Number 3 Region: 358-401,431-480
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000161
Family FIS-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334338676|ref|YP_004543656.1|
Sequence length 480
Comment sigma-54 factor interaction domain-containing protein [Desulfotomaculum ruminis DSM 2154]
Sequence
MNVNVLIVDGERQIQTLFKRILGSQVYRVTAVDDAKSAYLKLAQKNFKVAMINFKLRDTT
GLDLLQYIKNVQPECRCIIMTGYGSIETAIRAIQLGAYDYLEKPFESLEKVRRIVQSVGD
FGEKESNHTEFESIRSCADTVGMVIGNSKEMRKVITTAYKIANKKVNVLISGETGTGKDV
LARFIHAASDRKNNLFVPINCGALHESLLESELFGHEKGAFTGSNGTRKGIFELANKGTL
FLDELSEASQAIQVKLLRVLETGEFLRLGGEKPIKTDVRIITATNANIENLVRSRKFRKD
LYYRLNVVRLDLIPLRQRSEDIIEFVKHFAEKVAANYNHPTPPLFTELALHVLQCYPWYG
NVRELYSIIQKIVLKDVSGVIDIKHLPKDIINSFSRQNGQNQSNFSPQKFKIQRLKGIIH
SLNGLNNPQLEGKSSFHPRLLQDVEKEYIERTIEYYNGNVTLAARALGISRATLYRKIKQ
Download sequence
Identical sequences F6DLS7
gi|334338676|ref|YP_004543656.1| WP_013840152.1.34695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]