SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334338852|ref|YP_004543832.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334338852|ref|YP_004543832.1|
Domain Number 1 Region: 126-275
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.68e-21
Family N-acetyl transferase, NAT 0.031
Further Details:      
 
Weak hits

Sequence:  gi|334338852|ref|YP_004543832.1|
Domain Number - Region: 39-91
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0147
Family N-acetyl transferase, NAT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|334338852|ref|YP_004543832.1|
Sequence length 280
Comment N-acetyltransferase GCN5 [Desulfotomaculum ruminis DSM 2154]
Sequence
MEPVSRHKDEFSVDALVDKENLRIWIQDYRVKDPLLFSQYLTRWAKEESLEKIILPAREE
DLKSFQENGFVLEGVIEAYYPDSKGYFLSAYPCIRRGKSLFLQEEQAMLKKILSQPRLTK
GCLPEEFLLRRATKQDINRMADLFRQVFATYPTPIYTPRYLNCAMEKGDLYMVVYHGQQL
VGAAAAEIDRDYGRTELTNCATHPDYRGLGLNTLLLKELEQCCLNRHPRCLYSLARSSSY
GMNLILHRLGYRFQGTLINNCHIAGRFENMNLWVKPGLRI
Download sequence
Identical sequences F6DNK6
WP_013840323.1.34695 gi|334338852|ref|YP_004543832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]