SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334339005|ref|YP_004543985.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334339005|ref|YP_004543985.1|
Domain Number 1 Region: 11-136
Classification Level Classification E-value
Superfamily CheY-like 4.84e-42
Family CheY-related 0.0000666
Further Details:      
 
Domain Number 2 Region: 142-236
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.89e-28
Family PhoB-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|334339005|ref|YP_004543985.1|
Sequence length 239
Comment response regulator receiver [Desulfotomaculum ruminis DSM 2154]
Sequence
MGKNQLIQPEGTRPLVLLVDDETDLVTGLSNTLTEAGFRVVSAGDGGEALAVFRKALPDL
VILDLMLPVKDGLEVCGELRKISDVPIIMLTARDDSIDKILGLEFGADDYVTKPFNSREL
VARIRSILRRTRRQYQGSTLTVGKGRVCIHLNEQVVMVEGRQATLTPTELALLIHFARHP
GQVFSRMALLETVWGYDFPGDLRTVDVHVRRLRRKIEADPANPTIILTRFGVGYVLAQG
Download sequence
Identical sequences F6DQX5
WP_013840474.1.34695 gi|334339005|ref|YP_004543985.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]